Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6082
Gene name
LocationContig_6:48858..50295
Strand-
Gene length (bp)1437
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.5E-11 82 240
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.4E-07 105 211

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas sobria GN=pip PE=1 SV=3 16 476 3.0E-85

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3913
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6082 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7664
Ophiocordyceps camponoti-floridani Ophcf2|00407
Ophiocordyceps camponoti-rufipedis Ophun1|5340
Ophiocordyceps kimflemingae Ophio5|6351
Ophiocordyceps subramaniannii Hirsu2|7793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6082
MAHMAAELDIPPAKLLSSKSHAVPGQLLVTELFFRVPLDYADASAGTMTLFARCATKREPPPASPLDDDEQQQAA
KKQRPYMVYLEGGPGFGNRLPQDHPLTRTALARGYQLLFLDHRGVGLSTPVCSSLLLQMGDADAQVRYLRLMRQD
NTVRDCEAVRRCLTHGWPPAKASWSIFGQSYGGFIALSYLSMHPQGLREVFLTGGLAPIGKTPDQVYEATFRHTM
QRNRQYFEKYPQDAQTLRQLASHIQTFPDAALPLPAGGFLTLPRLLTLGIDFGGHGGFDNVHAMLLHLKASLDQF
GFLSRAALQPLETSTPFDTNIIYAILHEAIYCDGPGSPSNWAAYRVGKKLGPFSWLNPGYDGDTSEHTLYFSGEA
IFPFHFETYPELIPLRQAAEKLAAIQDWPKLYDEQRLRTNTVPVYAASYIHDMYVDYAFARDTHNMLGACKVFET
NMLYHSALRAKSEKVLQALFSLRDDVLD*
Coding >OphauG2|6082
ATGGCCCACATGGCCGCCGAGCTCGACATCCCCCCAGCCAAGCTGCTCAGCAGCAAAAGCCATGCAGTCCCGGGC
CAGCTGCTCGTCACAGAACTCTTCTTTCGAGTGCCTCTCGACTACGCCGACGCCTCAGCCGGCACCATGACTCTC
TTTGCCCGCTGCGCCACCAAGCGAGAGCCGCCCCCCGCCTCGCCTCTCGATGACGACGAGCAACAGCAGGCCGCC
AAGAAACAGCGCCCCTACATGGTCTACCTCGAGGGCGGCCCTGGCTTCGGCAACCGCCTGCCCCAGGACCACCCT
CTGACGCGCACTGCCCTCGCCCGCGGCTACCAGCTCCTCTTCCTCGACCATCGCGGCGTTGGGCTCAGCACCCCC
GTCTGCTCCAGCCTGCTCCTGCAAATGGGCGACGCCGACGCCCAGGTCCGCTACCTGCGCCTCATGCGCCAGGAC
AACACGGTTCGCGATTGCGAGGCCGTCCGTCGCTGCCTTACCCACGGCTGGCCCCCGGCCAAGGCATCCTGGTCC
ATCTTTGGCCAATCCTATGGCGGCTTCATTGCTCTCTCCTACCTCTCCATGCATCCCCAAGGCCTTCGCGAAGTC
TTCCTCACCGGAGGACTTGCTCCCATAGGCAAGACGCCCGACCAAGTCTATGAGGCCACCTTTCGCCACACTATG
CAGCGCAATCGCCAATACTTTGAAAAATACCCCCAAGATGCCCAGACCCTGCGCCAACTGGCCTCGCACATCCAG
ACATTTCCTGACGCTGCTCTTCCTCTCCCTGCCGGAGGCTTCCTTACCCTGCCCCGTTTGCTCACCCTCGGCATC
GACTTCGGAGGCCACGGCGGCTTTGATAACGTCCACGCCATGCTCCTCCATCTCAAGGCCTCCCTCGACCAGTTT
GGCTTCCTGTCCCGTGCTGCTCTTCAGCCCCTTGAAACATCGACTCCCTTCGACACCAACATCATCTACGCCATC
CTGCACGAGGCAATATACTGCGATGGGCCTGGCTCGCCCTCAAACTGGGCTGCTTATCGCGTCGGCAAGAAGCTC
GGGCCTTTTTCCTGGCTGAATCCCGGATACGACGGTGACACGTCTGAGCACACGCTCTACTTTTCCGGCGAGGCC
ATATTCCCCTTTCACTTTGAAACATACCCCGAGCTTATTCCCCTGCGACAGGCTGCTGAAAAGTTGGCCGCAATC
CAAGACTGGCCCAAGCTGTACGACGAGCAGCGCTTGCGCACCAACACGGTGCCAGTCTATGCTGCTTCCTACATC
CATGACATGTACGTCGACTACGCCTTTGCTCGTGATACACACAACATGCTTGGTGCGTGCAAGGTGTTTGAAACA
AACATGCTCTATCATTCCGCCCTGCGCGCCAAGTCGGAAAAGGTACTCCAGGCCTTGTTTAGCCTGAGAGACGAT
GTACTCGATTGA
Transcript >OphauG2|6082
ATGGCCCACATGGCCGCCGAGCTCGACATCCCCCCAGCCAAGCTGCTCAGCAGCAAAAGCCATGCAGTCCCGGGC
CAGCTGCTCGTCACAGAACTCTTCTTTCGAGTGCCTCTCGACTACGCCGACGCCTCAGCCGGCACCATGACTCTC
TTTGCCCGCTGCGCCACCAAGCGAGAGCCGCCCCCCGCCTCGCCTCTCGATGACGACGAGCAACAGCAGGCCGCC
AAGAAACAGCGCCCCTACATGGTCTACCTCGAGGGCGGCCCTGGCTTCGGCAACCGCCTGCCCCAGGACCACCCT
CTGACGCGCACTGCCCTCGCCCGCGGCTACCAGCTCCTCTTCCTCGACCATCGCGGCGTTGGGCTCAGCACCCCC
GTCTGCTCCAGCCTGCTCCTGCAAATGGGCGACGCCGACGCCCAGGTCCGCTACCTGCGCCTCATGCGCCAGGAC
AACACGGTTCGCGATTGCGAGGCCGTCCGTCGCTGCCTTACCCACGGCTGGCCCCCGGCCAAGGCATCCTGGTCC
ATCTTTGGCCAATCCTATGGCGGCTTCATTGCTCTCTCCTACCTCTCCATGCATCCCCAAGGCCTTCGCGAAGTC
TTCCTCACCGGAGGACTTGCTCCCATAGGCAAGACGCCCGACCAAGTCTATGAGGCCACCTTTCGCCACACTATG
CAGCGCAATCGCCAATACTTTGAAAAATACCCCCAAGATGCCCAGACCCTGCGCCAACTGGCCTCGCACATCCAG
ACATTTCCTGACGCTGCTCTTCCTCTCCCTGCCGGAGGCTTCCTTACCCTGCCCCGTTTGCTCACCCTCGGCATC
GACTTCGGAGGCCACGGCGGCTTTGATAACGTCCACGCCATGCTCCTCCATCTCAAGGCCTCCCTCGACCAGTTT
GGCTTCCTGTCCCGTGCTGCTCTTCAGCCCCTTGAAACATCGACTCCCTTCGACACCAACATCATCTACGCCATC
CTGCACGAGGCAATATACTGCGATGGGCCTGGCTCGCCCTCAAACTGGGCTGCTTATCGCGTCGGCAAGAAGCTC
GGGCCTTTTTCCTGGCTGAATCCCGGATACGACGGTGACACGTCTGAGCACACGCTCTACTTTTCCGGCGAGGCC
ATATTCCCCTTTCACTTTGAAACATACCCCGAGCTTATTCCCCTGCGACAGGCTGCTGAAAAGTTGGCCGCAATC
CAAGACTGGCCCAAGCTGTACGACGAGCAGCGCTTGCGCACCAACACGGTGCCAGTCTATGCTGCTTCCTACATC
CATGACATGTACGTCGACTACGCCTTTGCTCGTGATACACACAACATGCTTGGTGCGTGCAAGGTGTTTGAAACA
AACATGCTCTATCATTCCGCCCTGCGCGCCAAGTCGGAAAAGGTACTCCAGGCCTTGTTTAGCCTGAGAGACGAT
GTACTCGATTGA
Gene >OphauG2|6082
ATGGCCCACATGGCCGCCGAGCTCGACATCCCCCCAGCCAAGCTGCTCAGCAGCAAAAGCCATGCAGTCCCGGGC
CAGCTGCTCGTCACAGAACTCTTCTTTCGAGTGCCTCTCGACTACGCCGACGCCTCAGCCGGCACCATGACTCTC
TTTGCCCGCTGCGCCACCAAGCGAGAGCCGCCCCCCGCCTCGCCTCTCGATGACGACGAGCAACAGCAGGCCGCC
AAGAAACAGCGCCCCTACATGGTCTACCTCGAGGGCGGCCCTGGCTTCGGCAACCGCCTGCCCCAGGACCACCCT
CTGACGCGCACTGCCCTCGCCCGCGGCTACCAGCTCCTCTTCCTCGACCATCGCGGCGTTGGGCTCAGCACCCCC
GTCTGCTCCAGCCTGCTCCTGCAAATGGGCGACGCCGACGCCCAGGTCCGCTACCTGCGCCTCATGCGCCAGGAC
AACACGGTTCGCGATTGCGAGGCCGTCCGTCGCTGCCTTACCCACGGCTGGCCCCCGGCCAAGGCATCCTGGTCC
ATCTTTGGCCAATCCTATGGCGGCTTCATTGCTCTCTCCTACCTCTCCATGCATCCCCAAGGCCTTCGCGAAGTC
TTCCTCACCGGAGGACTTGCTCCCATAGGCAAGACGCCCGACCAAGTCTATGAGGCCACCTTTCGCCACACTATG
CAGCGCAATCGCCAATACTTTGAAAAATACCCCCAAGATGCCCAGACCCTGCGCCAACTGGCCTCGCACATCCAG
ACATTTCCTGACGCTGCTCTTCCTCTCCCTGCCGGAGGCTTCCTTACCCTGCCCCGTTTGCTCACCCTCGGCATC
GACTTCGGAGGCCACGGCGGCTTTGATAACGTCCACGCCATGCTCCTCCATCTCAAGGCCTCCCTCGACCAGTTT
GGCTTCCTGTCCCGTGCTGCTCTTCAGCCCCTTGAAACATCGACTCCCTTCGACACCAACATCATCTACGCCATC
CTGCACGAGGCAATATACTGCGATGGGCCTGGCTCGCCCTCAAACTGGGCTGCTTATCGCGTCGGCAAGAAGCTC
GGGCCTTTTTCCTGGCTGAATCCCGGATACGACGGTGACACGTCTGAGCACACGCTCTACTTTTCCGGCGAGGCC
ATATTCCCCTTTCACTTTGAAACATACCCCGAGCTTATTCCCCTGCGACAGGCTGCTGAAAAGTTGGCCGCAATC
CAAGACTGGCCCAAGCTGTACGACGAGCAGCGCTTGCGCACCAACACGGTGCCAGTCTATGCTGCTTCCTACATC
CATGACATGTACGTCGACTACGCCTTTGCTCGTGATACACACAACATGCTTGGTGCGTGCAAGGTGTTTGAAACA
AACATGCTCTATCATTCCGCCCTGCGCGCCAAGTCGGAAAAGGTACTCCAGGCCTTGTTTAGCCTGAGAGACGAT
GTACTCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail