Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6081
Gene name
LocationContig_6:47057..48689
Strand+
Gene length (bp)1632
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20470 HTH_61 Helix-turn-helix domain 2.3E-25 27 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 12 368 9.0E-50
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 1 384 7.0E-44
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 12 346 2.0E-42
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 12 342 1.0E-41
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 7 346 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 12 368 9.0E-50
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 1 384 7.0E-44
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 12 346 2.0E-42
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 12 342 1.0E-41
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 7 346 2.0E-32
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 12 350 9.0E-29
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 1 347 2.0E-26
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 12 357 1.0E-12
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 12 362 9.0E-11
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 11 349 3.0E-08
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 12 358 4.0E-08
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 1 341 8.0E-08
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 12 374 2.0E-07
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 1 358 9.0E-07
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 1 358 3.0E-06
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 11 340 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup972
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6080
Ophiocordyceps australis 1348a (Ghana) OphauG2|6081 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4050
Ophiocordyceps camponoti-floridani Ophcf2|00408
Ophiocordyceps camponoti-rufipedis Ophun1|5341
Ophiocordyceps kimflemingae Ophio5|6352
Ophiocordyceps subramaniannii Hirsu2|7791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6081
MGRDLVGPSMLRQMRGRAGRPGKCPVGETYLCCRQSDLDQVLELMQAEMPAISSCLSTDNRRVQRALLEAISTRL
ASSQESIDDYFAKSLLRHSHGRQFVKECTQSSSDEVQRMGLATCDSSGHWTATQLGKAIVASSIDPDDGVFVHRE
LTKALRAFAMDGEMHILYIFTPVQDFGVSVNWQVFRNEMDALDDNGLRVMSFVGIKPTELLRLAQGGSLKETTQE
EKEQARVYRRFYLALQLRDLCNEVPIHVVSRKYDMPRGAVQTLSHTCQGFAAGMVKFCEHMGWGVMAAALDHFTD
RLMAGARADLLALTKIPFIKSRTARVFWESGYRSIASVANADAGQLLPVLMQPNKIRSKGHKDEKLQEKLLAKAQ
IISMAANRIWQIQVQAELQED*
Coding >OphauG2|6081
ATGGGCCGCGATTTGGTTGGCCCGTCTATGCTCAGGCAGATGAGGGGTCGGGCTGGACGGCCGGGCAAATGTCCT
GTTGGCGAGACATATCTCTGTTGCCGACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCA
GCAATTTCAAGCTGTCTGAGCACCGATAACAGACGAGTTCAACGCGCGCTCTTGGAAGCCATTTCAACCCGCCTG
GCAAGCAGCCAAGAATCCATCGACGATTACTTTGCTAAATCATTGCTCAGGCATTCGCATGGCAGACAATTCGTC
AAGGAGTGCACCCAGTCAAGCTCAGACGAGGTGCAGCGAATGGGCCTGGCAACGTGCGACAGCTCGGGCCACTGG
ACTGCAACGCAGCTGGGCAAAGCAATTGTTGCATCATCCATCGATCCCGACGATGGCGTCTTTGTTCACCGAGAG
CTGACCAAGGCGCTGCGGGCATTTGCAATGGATGGGGAGATGCACATTTTGTACATCTTTACCCCTGTTCAGGAC
TTTGGCGTCTCGGTAAACTGGCAAGTGTTTCGCAACGAGATGGATGCACTAGATGACAATGGGCTGCGTGTGATG
AGCTTTGTTGGCATCAAACCGACGGAGCTTCTTCGACTGGCTCAGGGGGGCTCCCTCAAAGAGACAACTCAGGAG
GAAAAAGAGCAGGCACGGGTATATCGCCGCTTTTACCTGGCACTTCAGCTTCGCGACCTGTGCAACGAAGTCCCA
ATACACGTTGTCTCTCGCAAGTACGACATGCCTCGAGGAGCCGTCCAGACTCTGTCGCATACGTGCCAAGGCTTT
GCCGCCGGCATGGTCAAGTTTTGCGAGCACATGGGGTGGGGGGTTATGGCGGCAGCGCTAGATCATTTCACAGAT
CGGCTCATGGCGGGAGCTAGAGCTGATCTCTTGGCTTTGACCAAGATTCCTTTCATCAAGAGCCGCACAGCCCGC
GTCTTCTGGGAGAGTGGCTACAGAAGCATCGCATCAGTCGCCAACGCCGATGCCGGACAATTGTTGCCGGTTCTG
ATGCAGCCCAACAAGATACGCTCCAAGGGGCACAAGGACGAAAAGCTTCAAGAGAAGCTACTTGCCAAAGCTCAA
ATCATATCAATGGCAGCCAATCGAATATGGCAGATTCAAGTGCAGGCCGAATTGCAGGAGGATTAG
Transcript >OphauG2|6081
ATGGGCCGCGATTTGGTTGGCCCGTCTATGCTCAGGCAGATGAGGGGTCGGGCTGGACGGCCGGGCAAATGTCCT
GTTGGCGAGACATATCTCTGTTGCCGACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCA
GCAATTTCAAGCTGTCTGAGCACCGATAACAGACGAGTTCAACGCGCGCTCTTGGAAGCCATTTCAACCCGCCTG
GCAAGCAGCCAAGAATCCATCGACGATTACTTTGCTAAATCATTGCTCAGGCATTCGCATGGCAGACAATTCGTC
AAGGAGTGCACCCAGTCAAGCTCAGACGAGGTGCAGCGAATGGGCCTGGCAACGTGCGACAGCTCGGGCCACTGG
ACTGCAACGCAGCTGGGCAAAGCAATTGTTGCATCATCCATCGATCCCGACGATGGCGTCTTTGTTCACCGAGAG
CTGACCAAGGCGCTGCGGGCATTTGCAATGGATGGGGAGATGCACATTTTGTACATCTTTACCCCTGTTCAGGAC
TTTGGCGTCTCGGTAAACTGGCAAGTGTTTCGCAACGAGATGGATGCACTAGATGACAATGGGCTGCGTGTGATG
AGCTTTGTTGGCATCAAACCGACGGAGCTTCTTCGACTGGCTCAGGGGGGCTCCCTCAAAGAGACAACTCAGGAG
GAAAAAGAGCAGGCACGGGTATATCGCCGCTTTTACCTGGCACTTCAGCTTCGCGACCTGTGCAACGAAGTCCCA
ATACACGTTGTCTCTCGCAAGTACGACATGCCTCGAGGAGCCGTCCAGACTCTGTCGCATACGTGCCAAGGCTTT
GCCGCCGGCATGGTCAAGTTTTGCGAGCACATGGGGTGGGGGGTTATGGCGGCAGCGCTAGATCATTTCACAGAT
CGGCTCATGGCGGGAGCTAGAGCTGATCTCTTGGCTTTGACCAAGATTCCTTTCATCAAGAGCCGCACAGCCCGC
GTCTTCTGGGAGAGTGGCTACAGAAGCATCGCATCAGTCGCCAACGCCGATGCCGGACAATTGTTGCCGGTTCTG
ATGCAGCCCAACAAGATACGCTCCAAGGGGCACAAGGACGAAAAGCTTCAAGAGAAGCTACTTGCCAAAGCTCAA
ATCATATCAATGGCAGCCAATCGAATATGGCAGATTCAAGTGCAGGCCGAATTGCAGGAGGATTAG
Gene >OphauG2|6081
ATGGGCCGCGATTTGGTTGGCCCGTCTATGCTCAGGCAGATGAGGGGTCGGGCTGGACGGCCGGGCAAATGTCCT
GTTGGCGAGACATATCTCTGTTGCCGACAAAGCGACTTGGATCAGGTCCTGGAGCTTATGCAGGCCGAGATGCCA
GCAATTTCAAGCTGTCTGAGCACCGATAACAGACGAGTTCAACGGTGAGTTCGAGGCTGATATTTTGATGCTGAC
ATTATGGCGGTTTGACACGGGCCGGGACTGGCGAGTTCTCGCTGACTGGACCATCAGCGCGCTCTTGGAAGCCAT
TTCAACCCGCCTGGCAAGCAGCCAAGAATCCATCGACGATTACTTTGCTAAATCATTGCTCAGGCATTCGCATGG
CAGACAATTCGTCAAGGAGTGCACCCAGTCAAGCTCAGACGAGGTGCAGCGAATGGGCCTGGCAACGTGCGACAG
CTCGGGCCACTGGACTGCAACGCAGCTGGGCAAAGCAATTGTTGCATCATCCATCGATCCCGACGATGGCGTCTT
TGTTCACCGAGAGCTGACCAAGGCGCTGCGGGCATTTGCAATGGATGGGGAGATGCACATTTTGTACATCTTTAC
CCCTGTTCAGGACTTTGGCGTCTCGGTAAACTGGCAAGTGTTTCGCAACGAGATGGATGCACTAGATGACAATGG
GCTGCGTGTGATGAGCTTTGTTGGCATCAAACCGACGGAGCTTCTTCGACTGTGAGTTGCGTCGTGGCAACAGAA
ACGACGCTGCAGCGGCTGACACGGCACGCCAGGGCTCAGGGGGGCTCCCTCAAAGAGACAACTCAGGAGGAAAAA
GAGCAGGCACGGGTATATCGCCGCTTTTACCTGGCACTTCAGCTTCGCGACCTGTGCAACGAAGTCCCAATACAC
GTTGTCTCTCGCAAGTACGACATGCCTCGAGGAGCCGTCCAGACTCTGTCGCATACGTGCCAAGGCTTTGCCGCC
GGCATGGTCAAGTTTTGCGAGCACATGGGGTGGGGGTGAGTCAAGCAATGACGCTTCACTGGTTCAGCTGCGACT
GACTGCTTGCTCGACGCAGGGTTATGGCGGCAGCGCTAGATCATTTCACAGATCGGCTCATGGCGGGAGCTAGAG
CTGATCTCTTGGCTTTGACCAAGATTCCTTTCATCAAGAGCCGCACAGCGTAAGTTTCCTCGAGTCGTGGCGTCG
GTCAAGAAACAGAGAGAGAGAGAAAATCCCGACTAATGCATCAGTGGAAAGCCGCGTCTTCTGGGAGAGTGGCTA
CAGAAGCATCGCATCAGTCGCCAACGCCGATGCCGGACAATTGTTGCCGGTTCTGATGCAGGTTTGTCTGATGGC
ACATGGAATGGGCGCAGTCTTGTTACGTGTTCAACGCTGACTAGAGAGCCAACTATCATCATGATGGCCCTTTTC
CCCCTGACAGGCCCAGCCCAACAAGATACGCTCCAAGGGGCACAAGGACGAAAAGCTTCAAGAGAAGCTACTTGC
CAAAGCTCAAATCATATCAATGGCAGCCAATCGAATATGGCGTAAGTCGAACTGGAATTACACAGTCGGTGACGC
GATTACTGAGAGCCAATGACAGAGATTCAAGTGCAGGCCGAATTGCAGGAGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail