Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6074
Gene name
LocationContig_6:23908..24987
Strand+
Gene length (bp)1079
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00466 Ribosomal_L10 Ribosomal protein L10 1.1E-21 5 100
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 1.9E-21 109 178
PF00428 Ribosomal_60s 60s Acidic ribosomal protein 1.1E-18 229 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96TJ5|RLA0_NEUCR 60S acidic ribosomal protein P0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=p0 PE=2 SV=1 1 269 1.0E-160
sp|Q9C3Z6|RLA0_PODAS 60S acidic ribosomal protein P0 OS=Podospora anserina PE=3 SV=1 1 267 9.0E-159
sp|P05317|RLA0_YEAST 60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP0 PE=1 SV=2 1 314 5.0E-123
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 1 314 2.0E-121
sp|Q9DG68|RLA0_RANSY 60S acidic ribosomal protein P0 OS=Rana sylvatica GN=RPLP0 PE=2 SV=1 8 273 5.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96TJ5|RLA0_NEUCR 60S acidic ribosomal protein P0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=p0 PE=2 SV=1 1 269 1.0E-160
sp|Q9C3Z6|RLA0_PODAS 60S acidic ribosomal protein P0 OS=Podospora anserina PE=3 SV=1 1 267 9.0E-159
sp|P05317|RLA0_YEAST 60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP0 PE=1 SV=2 1 314 5.0E-123
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 1 314 2.0E-121
sp|Q9DG68|RLA0_RANSY 60S acidic ribosomal protein P0 OS=Rana sylvatica GN=RPLP0 PE=2 SV=1 8 273 5.0E-103
sp|Q9U3U0|RLA0_CERCA 60S acidic ribosomal protein P0 OS=Ceratitis capitata GN=RpLP0 PE=3 SV=1 4 273 5.0E-99
sp|Q93572|RLA0_CAEEL 60S acidic ribosomal protein P0 OS=Caenorhabditis elegans GN=rpa-0 PE=1 SV=3 4 314 5.0E-98
sp|P19889|RLA0_DROME 60S acidic ribosomal protein P0 OS=Drosophila melanogaster GN=RpLP0 PE=1 SV=1 4 273 2.0E-97
sp|P47826|RLA0_CHICK 60S acidic ribosomal protein P0 OS=Gallus gallus GN=RPLP0 PE=2 SV=1 8 270 5.0E-96
sp|P05388|RLA0_HUMAN 60S acidic ribosomal protein P0 OS=Homo sapiens GN=RPLP0 PE=1 SV=1 8 273 7.0E-96
sp|Q95140|RLA0_BOVIN 60S acidic ribosomal protein P0 OS=Bos taurus GN=RPLP0 PE=2 SV=3 8 273 7.0E-96
sp|Q29214|RLA0_PIG 60S acidic ribosomal protein P0 OS=Sus scrofa GN=RPLP0 PE=1 SV=2 8 273 1.0E-95
sp|P14869|RLA0_MOUSE 60S acidic ribosomal protein P0 OS=Mus musculus GN=Rplp0 PE=1 SV=3 8 273 1.0E-95
sp|Q9PV90|RLA0_DANRE 60S acidic ribosomal protein P0 OS=Danio rerio GN=rplp0 PE=2 SV=1 8 314 1.0E-94
sp|Q90YX1|RLA0_ICTPU 60S acidic ribosomal protein P0 OS=Ictalurus punctatus GN=rplp0 PE=2 SV=1 8 273 2.0E-94
sp|P19945|RLA0_RAT 60S acidic ribosomal protein P0 OS=Rattus norvegicus GN=Rplp0 PE=1 SV=2 8 264 2.0E-92
sp|Q8NHW5|RLA0L_HUMAN 60S acidic ribosomal protein P0-like OS=Homo sapiens GN=RPLP0P6 PE=5 SV=1 8 270 5.0E-91
sp|P41095|RLA0_ORYSJ 60S acidic ribosomal protein P0 OS=Oryza sativa subsp. japonica GN=Os08g0130500 PE=1 SV=3 4 287 2.0E-89
sp|P50346|RLA0_SOYBN 60S acidic ribosomal protein P0 OS=Glycine max PE=2 SV=1 4 273 4.0E-89
sp|Q42112|RLA02_ARATH 60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana GN=RPP0B PE=1 SV=2 4 273 3.0E-86
sp|O04204|RLA01_ARATH 60S acidic ribosomal protein P0-1 OS=Arabidopsis thaliana GN=RPP0A PE=1 SV=1 4 283 4.0E-86
sp|P57691|RLA03_ARATH 60S acidic ribosomal protein P0-3 OS=Arabidopsis thaliana GN=RPP0C PE=1 SV=1 4 273 6.0E-85
sp|O24573|RLA0_MAIZE 60S acidic ribosomal protein P0 OS=Zea mays GN=RP-P0 PE=1 SV=3 4 279 1.0E-84
sp|P50345|RLA0_LUPLU 60S acidic ribosomal protein P0 OS=Lupinus luteus PE=2 SV=1 4 270 1.0E-74
sp|Q94660|RLA0_PLAF8 60S acidic ribosomal protein P0 OS=Plasmodium falciparum (isolate 7G8) GN=RPLP0 PE=2 SV=2 4 271 1.0E-73
sp|P29764|RLA0_OXYRB 60S acidic ribosomal protein P0 OS=Oxybasis rubra PE=2 SV=1 4 238 2.0E-70
sp|P22685|RLA0_DICDI 60S acidic ribosomal protein P0 OS=Dictyostelium discoideum GN=rplp0 PE=1 SV=2 2 264 9.0E-67
sp|Q967Y7|RLA0_EIMTE 60S acidic ribosomal protein P0 OS=Eimeria tenella PE=2 SV=1 5 269 4.0E-64
sp|P26796|RLA0_TRYCR 60S acidic ribosomal protein P0 OS=Trypanosoma cruzi PE=2 SV=2 5 261 4.0E-61
sp|P39096|RLA0_LEICH 60S acidic ribosomal protein P0 OS=Leishmania chagasi GN=LCP0 PE=3 SV=1 8 259 1.0E-54
sp|Q8SRJ7|RLA0_ENCCU 60S acidic ribosomal protein P0 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPP0 PE=1 SV=2 12 259 1.0E-52
sp|P39097|RLA0_LEIIN 60S acidic ribosomal protein P0 OS=Leishmania infantum GN=LIPO-A PE=3 SV=1 8 259 3.0E-51
sp|P15826|RL10_METVS 50S ribosomal protein L10 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl10 PE=1 SV=2 15 255 9.0E-33
sp|Q8TZJ8|RL10_PYRFU 50S ribosomal protein L10 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl10 PE=1 SV=1 13 255 9.0E-31
sp|Q6M0L1|RL10_METMP 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl10 PE=1 SV=1 15 255 2.0E-30
sp|B6YSX9|RL10_THEON 50S ribosomal protein L10 OS=Thermococcus onnurineus (strain NA1) GN=rpl10 PE=3 SV=1 12 262 2.0E-30
sp|Q8TX50|RL10_METKA 50S ribosomal protein L10 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10 PE=3 SV=2 14 259 3.0E-30
sp|O74109|RL10_PYRHO 50S ribosomal protein L10 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl10 PE=1 SV=1 13 255 4.0E-30
sp|Q9UXS5|RL10_PYRAB 50S ribosomal protein L10 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl10 PE=3 SV=1 13 255 6.0E-30
sp|A4FZS8|RL10_METM5 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl10 PE=3 SV=1 15 255 2.0E-29
sp|Q5JH36|RL10_THEKO 50S ribosomal protein L10 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl10 PE=3 SV=1 12 255 2.0E-29
sp|A9A838|RL10_METM6 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl10 PE=3 SV=1 15 255 5.0E-29
sp|O52705|RL10_METTL 50S ribosomal protein L10 OS=Methanothermococcus thermolithotrophicus GN=rpl10 PE=3 SV=1 13 255 6.0E-29
sp|A5UKU8|RL10_METS3 50S ribosomal protein L10 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl10 PE=3 SV=1 12 285 7.0E-29
sp|A6UTF8|RL10_META3 50S ribosomal protein L10 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl10 PE=3 SV=1 13 255 4.0E-28
sp|P13553|RL10_HALSA 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10 PE=3 SV=1 14 260 2.0E-27
sp|B0R4W1|RL10_HALS3 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10 PE=3 SV=1 14 260 2.0E-27
sp|Q9Y8J3|RL10_METVO 50S ribosomal protein L10 (Fragment) OS=Methanococcus voltae GN=rpl10 PE=3 SV=1 8 255 2.0E-27
sp|A6VIP9|RL10_METM7 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl10 PE=3 SV=1 15 255 4.0E-27
sp|Q3INI7|RL10_NATPD 50S ribosomal protein L10 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl10 PE=3 SV=1 8 260 3.0E-26
sp|C5A428|RL10_THEGJ 50S ribosomal protein L10 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl10 PE=3 SV=1 13 262 3.0E-26
sp|O27717|RL10_METTH 50S ribosomal protein L10 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl10 PE=3 SV=1 14 237 7.0E-26
sp|P41198|RL10_HALVD 50S ribosomal protein L10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl10 PE=3 SV=2 13 259 8.0E-26
sp|P15825|RL10_HALMA 50S ribosomal protein L10 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10 PE=1 SV=2 8 260 8.0E-26
sp|P54049|RL10_METJA 50S ribosomal protein L10 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl10 PE=1 SV=2 15 255 5.0E-25
sp|Q2NEW2|RL10_METST 50S ribosomal protein L10 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl10 PE=3 SV=1 14 238 4.0E-24
sp|C6A1F5|RL10_THESM 50S ribosomal protein L10 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl10 PE=3 SV=1 13 255 5.0E-24
sp|Q971J2|RL10_SULTO 50S ribosomal protein L10 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl10 PE=3 SV=2 14 277 2.0E-23
sp|Q6L1X8|RL10_PICTO 50S ribosomal protein L10 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl10 PE=3 SV=1 8 255 3.0E-22
sp|P96039|RL10_SULSO 50S ribosomal protein L10 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl10 PE=3 SV=2 15 276 2.0E-21
sp|Q8ZTT3|RL10_PYRAE 50S ribosomal protein L10 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl10 PE=3 SV=1 6 250 2.0E-21
sp|C3MZC0|RL10_SULIA 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl10 PE=3 SV=1 15 276 3.0E-21
sp|Q8PY51|RL10_METMA 50S ribosomal protein L10 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl10 PE=3 SV=1 8 251 3.0E-21
sp|Q46EU9|RL10_METBF 50S ribosomal protein L10 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl10 PE=1 SV=1 18 235 3.0E-21
sp|P35023|RL10_SULAC 50S ribosomal protein L10 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl10 PE=3 SV=1 19 277 2.0E-20
sp|C3N7E1|RL10_SULIY 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl10 PE=3 SV=1 15 276 3.0E-20
sp|C3MR85|RL10_SULIL 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl10 PE=3 SV=1 15 276 3.0E-20
sp|C3NG93|RL10_SULIN 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl10 PE=3 SV=1 15 276 3.0E-20
sp|C3MXH4|RL10_SULIM 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl10 PE=3 SV=1 15 276 9.0E-20
sp|C4KIJ9|RL10_SULIK 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl10 PE=3 SV=1 15 276 9.0E-20
sp|Q8TI80|RL10_METAC 50S ribosomal protein L10 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl10 PE=3 SV=1 8 235 2.0E-19
sp|A8ABQ7|RL10_IGNH4 50S ribosomal protein L10 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl10 PE=3 SV=1 8 255 2.0E-18
sp|Q12UP8|RL10_METBU 50S ribosomal protein L10 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl10 PE=3 SV=1 8 263 2.0E-18
sp|A3DNI2|RL10_STAMF 50S ribosomal protein L10 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl10 PE=3 SV=1 15 277 5.0E-18
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 7 208 1.0E-14
sp|O28781|RL10_ARCFU 50S ribosomal protein L10 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl10 PE=3 SV=1 2 228 1.0E-14
sp|Q97BN3|RL10_THEVO 50S ribosomal protein L10 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl10 PE=3 SV=1 23 313 3.0E-12
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 7 179 3.0E-11
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 7 192 3.0E-11
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 7 192 4.0E-10
sp|P57692|RL10_THEAC 50S ribosomal protein L10 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl10 PE=3 SV=1 5 224 4.0E-10
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 15 185 6.0E-10
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 8 124 6.0E-10
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 8 192 3.0E-09
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 8 193 8.0E-09
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 8 192 1.0E-08
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 8 192 1.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3785
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6074 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1694
Ophiocordyceps camponoti-floridani Ophcf2|00398
Ophiocordyceps camponoti-rufipedis Ophun1|3969
Ophiocordyceps kimflemingae Ophio5|1920
Ophiocordyceps subramaniannii Hirsu2|7383

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6074
MGGKSANKAGYFDKLKGLLEEYKSIFIVTIDNVSSQQMHEIRHGLRGEGVVLMGKNTMVRRALRTFITDTPEYEK
LLPYVKGNVGFVFTNKDLKSVRDKLLSNRVAAPARAGALAPIDVWVPAGNTGMEPGKTSFFQALQVPTKIARGTI
EITTDLKLVEAGTKVGPSEATLLNMLNISPFTYGMGIAQVYDQGQTFPAEILDIGDEQLLGALSKCITTIASISL
AINYPTMASVMHSLVNTYKKALAVAIETEYSWPEIEELKDRIANPEAYAAAAPAAAAGGASAAADSKPAEEKKDE
SEEEDDEGFGGLFD*
Coding >OphauG2|6074
ATGGGGGGCAAGTCCGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAAGAGTACAAGTCCATC
TTCATCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTCTGATGGGCAAGAACACCATGGTTCGTCGCGCCCTCAGGACCTTCATCACCGATACTCCCGAGTACGAGAAA
CTTCTGCCCTATGTCAAGGGCAACGTCGGCTTTGTTTTCACCAACAAAGACCTCAAATCTGTTCGCGACAAGCTA
CTGTCGAACCGCGTCGCTGCTCCAGCCCGTGCTGGCGCCCTTGCTCCCATCGATGTCTGGGTCCCCGCCGGAAAC
ACGGGCATGGAACCCGGCAAAACGTCCTTTTTTCAGGCCCTTCAGGTGCCCACCAAGATCGCCCGTGGCACGATT
GAAATCACGACGGATTTGAAACTCGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAACATG
CTCAACATCTCGCCCTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAAGGCCAGACCTTCCCGGCCGAG
ATTCTCGATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGCATCACTACCATTGCCTCCATCTCTCTC
GCAATCAACTATCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTGCAGTTGCC
ATTGAGACGGAATACAGCTGGCCTGAAATTGAGGAACTCAAAGACCGCATCGCCAATCCCGAGGCTTATGCTGCT
GCTGCTCCTGCTGCGGCTGCTGGAGGCGCCAGTGCCGCCGCAGACTCTAAGCCTGCCGAGGAGAAAAAGGACGAA
TCTGAGGAGGAGGATGACGAAGGTTTTGGTGGCCTCTTTGACTAA
Transcript >OphauG2|6074
ATGGGGGGCAAGTCCGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAAGAGTACAAGTCCATC
TTCATCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTCTGATGGGCAAGAACACCATGGTTCGTCGCGCCCTCAGGACCTTCATCACCGATACTCCCGAGTACGAGAAA
CTTCTGCCCTATGTCAAGGGCAACGTCGGCTTTGTTTTCACCAACAAAGACCTCAAATCTGTTCGCGACAAGCTA
CTGTCGAACCGCGTCGCTGCTCCAGCCCGTGCTGGCGCCCTTGCTCCCATCGATGTCTGGGTCCCCGCCGGAAAC
ACGGGCATGGAACCCGGCAAAACGTCCTTTTTTCAGGCCCTTCAGGTGCCCACCAAGATCGCCCGTGGCACGATT
GAAATCACGACGGATTTGAAACTCGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAACATG
CTCAACATCTCGCCCTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAAGGCCAGACCTTCCCGGCCGAG
ATTCTCGATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGCATCACTACCATTGCCTCCATCTCTCTC
GCAATCAACTATCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTGCAGTTGCC
ATTGAGACGGAATACAGCTGGCCTGAAATTGAGGAACTCAAAGACCGCATCGCCAATCCCGAGGCTTATGCTGCT
GCTGCTCCTGCTGCGGCTGCTGGAGGCGCCAGTGCCGCCGCAGACTCTAAGCCTGCCGAGGAGAAAAAGGACGAA
TCTGAGGAGGAGGATGACGAAGGTTTTGGTGGCCTCTTTGACTAA
Gene >OphauG2|6074
ATGGGGGGCAAGTCCGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAAGAGTACAAGTCCATC
TTCATCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTCTGATGGGCAAGAACACCATGGTAATGCCCTCAGCCCCTCCATCTCCCCCCCAAAAAGGCGTCACGGTTGTC
AAGAGCCAGCCCTAACTTGCCCCCTAGGTTCGTCGCGCCCTCAGGACCTTCATCACCGATACTCCCGAGTACGAG
AAACTTCTGCCCTATGTCAAGGGCAACGTCGGCTTTGTTTTCACCAACAAAGACCTCAAATCTGTTCGCGACAAG
CTACTGTCGAACCGCGTCGCTGCTCCAGCCCGTGCTGGCGCCCTTGCTCCCATCGATGTCTGGGTCCCCGCCGGA
AACACGGGCATGGAACCCGGCAAAACGTCCTTTTTTCAGGCCCTTCAGGTGCCCACCAAGATCGCCCGTGGCACG
ATTGAAATCACGACGGATTTGAAACTCGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAAC
ATGCTCAACATCTCGCCCTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAAGGCCAGACCTTCCCGGCC
GAGATTCTCGATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGCATCACTACCATTGCCTCCATCTCT
CTCGCAATCAACTATCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTGCAGTT
GCCATTGAGACGGAATACAGCTGGCCTGAAATTGAGGAACTCAAAGACCGCATCGCCAATCCCGAGGCTTATGCT
GCTGCTGCTCCTGCTGCGGCTGCTGGAGGCGCCAGTGCCGCCGCAGACTCTAAGCCTGCCGAGGAGAAAAAGGAC
GAATCTGAGGAGGAGGATGACGAAGGTTTTGGTGGCCTCTTGTACGTGACGACGCCCCCTTTCGCCTGCTTGTGT
CTTGAGCTGATTTTCTCCACAGTGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail