Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6069
Gene name
LocationContig_6:9452..12262
Strand-
Gene length (bp)2810
Transcript length (bp)2745
Coding sequence length (bp)2745
Protein length (aa) 915

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04147 Nop14 Nop14-like family 4.2E-279 50 896

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CT09|NOP14_KLULA Probable nucleolar complex protein 14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP14 PE=3 SV=1 1 912 5.0E-114
sp|Q6C2F4|NOP14_YARLI Probable nucleolar complex protein 14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP14 PE=3 SV=1 4 912 1.0E-112
sp|O43051|NOP14_SCHPO Probable nucleolar complex protein 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop14 PE=1 SV=1 3 891 2.0E-111
sp|Q75A47|NOP14_ASHGO Probable nucleolar complex protein 14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP14 PE=3 SV=1 1 908 3.0E-104
sp|Q6FNV1|NOP14_CANGA Probable nucleolar complex protein 14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP14 PE=3 SV=1 1 914 5.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CT09|NOP14_KLULA Probable nucleolar complex protein 14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP14 PE=3 SV=1 1 912 5.0E-114
sp|Q6C2F4|NOP14_YARLI Probable nucleolar complex protein 14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP14 PE=3 SV=1 4 912 1.0E-112
sp|O43051|NOP14_SCHPO Probable nucleolar complex protein 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop14 PE=1 SV=1 3 891 2.0E-111
sp|Q75A47|NOP14_ASHGO Probable nucleolar complex protein 14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP14 PE=3 SV=1 1 908 3.0E-104
sp|Q6FNV1|NOP14_CANGA Probable nucleolar complex protein 14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP14 PE=3 SV=1 1 914 5.0E-99
sp|Q99207|NOP14_YEAST Nucleolar complex protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP14 PE=1 SV=1 1 908 1.0E-95
sp|Q6BW57|NOP14_DEBHA Probable nucleolar complex protein 14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP14 PE=3 SV=1 1 909 9.0E-78
sp|P78316|NOP14_HUMAN Nucleolar protein 14 OS=Homo sapiens GN=NOP14 PE=1 SV=3 57 895 1.0E-75
sp|Q8R3N1|NOP14_MOUSE Nucleolar protein 14 OS=Mus musculus GN=Nop14 PE=1 SV=2 57 385 4.0E-28
sp|Q9VEJ2|NOP14_DROME Nucleolar protein 14 homolog OS=Drosophila melanogaster GN=l(3)07882 PE=2 SV=2 471 909 7.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:0030684 preribosome No
GO:0032991 protein-containing complex No
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3503
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6069 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1689
Ophiocordyceps camponoti-floridani Ophcf2|00390
Ophiocordyceps camponoti-rufipedis Ophun1|3957
Ophiocordyceps kimflemingae Ophio5|1912
Ophiocordyceps subramaniannii Hirsu2|6700

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6069
MVGSQLKRLRASLREQGITGPQQSKKQKRQRAQHGHVGSDKRLQRGIVLQGIHEQFNPFDIKHAARGPKFSVTTN
RPAMGDAAKGIKGRPGLAKAAGEERRRETLLVDMQHRNKIGGIIDRRFGENDPSIAPEEKMLERFAREKQASHKK
NAIFDLEDDAPLNGGLTHMGKPLVFDQDDESAIADDFREFDLDEDQDSDDSVRGTQRLKRMRAMVLNGQDDDEPE
RKKTKKEVMQEVIAKSKLHKYERQAAKADDADLRAELDKGLPSIKMLFSFSDKNTAHPATAAALAPATTGSVHDV
SDKDYNLKVKRLAQDKRAQPTERTKTEEEQLEEKANILKELETKRQRRMLGEEASDSDDDEQNGQQERMKAHAVN
DDDDDDDFGLGGGLKSRPRAKDHVFDDEDDFIIDDGLIASGSDIESMGLDEHDSDTAACFPQETQTDEDEDFIGG
LFGQEETKKIGFKSVAASSKTVSGELDERGLPYTFVCPQSCQEFTSLAEPYPQEALPTIIQRIRTLYHPGLDSDN
KVKLARFAEILVEFISQPWDAHTSPPFLVLESIIRHIHSLAKSYPIQIARRFRHEIQSIARTRPLSLLPSDLLLL
TAVGTIFPTSDHFHQVVTPAMLTIGRFLGQRVPRNLSDYVCGTYLSILALQYQQRSKRYVPELINFCLNALCALS
PVPPKKKLGNFPQHEPPTGIRLRKDKIPAPRRLRLLDCIAADVDDKEAVSVKMAVIDTCIQLLDVTADVWTGKSA
FLETLQQVMGVIRHLMRRACREYLPSQTGERIERIQAKLERMMRLAQMARRPLELHHHRPLAIKSYVPRFEDSFN
PDKHYDPDRERAELAKLQKEHKRERKGAMRELRKDAHFMAREKLRIKKAKDEAYEKKFQRIVSEIQSEEGREANA
YKRDMEARKRARNK*
Coding >OphauG2|6069
ATGGTCGGGTCGCAGCTCAAGCGTCTCAGAGCGTCTTTGCGAGAGCAGGGCATCACCGGGCCTCAGCAGTCAAAG
AAGCAAAAACGCCAACGGGCACAGCATGGTCATGTCGGTAGCGACAAGAGATTGCAGAGAGGCATTGTCTTGCAA
GGCATTCACGAACAGTTCAATCCGTTCGATATCAAGCATGCCGCCAGAGGCCCCAAATTTTCCGTCACAACCAAC
CGGCCGGCCATGGGCGATGCCGCAAAGGGCATCAAAGGCCGGCCTGGCTTGGCCAAAGCAGCCGGCGAAGAAAGA
CGTCGAGAGACATTGCTTGTTGACATGCAACACCGTAACAAGATTGGCGGAATCATTGATCGACGTTTCGGAGAA
AATGATCCCTCAATAGCACCAGAGGAGAAGATGTTGGAACGCTTTGCTCGTGAAAAGCAAGCAAGTCACAAGAAG
AATGCCATTTTCGACTTGGAGGATGACGCGCCTCTCAATGGCGGACTTACGCACATGGGAAAGCCCCTCGTTTTT
GATCAAGATGACGAATCGGCAATCGCAGATGATTTTCGAGAATTTGATTTGGATGAGGACCAAGATAGCGATGAC
TCGGTGCGAGGAACCCAGCGTCTGAAGCGTATGCGTGCCATGGTCTTGAATGGCCAAGACGACGACGAGCCGGAG
CGCAAGAAGACAAAAAAGGAGGTCATGCAGGAAGTCATTGCCAAATCAAAGTTGCACAAGTACGAACGCCAAGCG
GCCAAGGCAGACGATGCTGACTTGCGCGCTGAGCTGGACAAGGGACTTCCGAGCATCAAAATGCTCTTCTCTTTC
AGTGACAAAAACACGGCACATCCAGCCACTGCTGCAGCACTCGCACCGGCCACTACTGGCTCGGTTCACGACGTG
TCGGATAAAGATTACAACTTAAAGGTCAAGCGCTTGGCTCAGGACAAACGAGCACAGCCCACAGAGAGGACCAAG
ACCGAGGAGGAACAGCTAGAAGAAAAGGCAAATATATTGAAAGAGCTGGAAACCAAACGACAAAGACGCATGCTA
GGAGAAGAGGCTTCTGACAGCGATGACGACGAACAAAACGGCCAACAAGAGCGCATGAAAGCACACGCCGTCAAT
GATGATGATGATGACGACGACTTTGGCCTGGGAGGAGGCTTAAAGTCGCGGCCCAGAGCCAAGGATCACGTCTTT
GACGACGAAGATGATTTCATCATTGATGACGGATTAATTGCCAGCGGCTCCGACATTGAGTCAATGGGCCTTGAT
GAGCACGATTCCGACACTGCAGCATGTTTCCCACAAGAAACTCAAACAGACGAAGACGAAGACTTCATTGGAGGC
CTGTTTGGCCAAGAAGAAACCAAAAAAATTGGTTTCAAATCTGTAGCTGCCTCATCAAAAACGGTTTCTGGAGAG
CTGGATGAGCGCGGGCTGCCGTACACCTTTGTTTGCCCGCAATCATGTCAAGAGTTCACGTCTCTCGCAGAGCCC
TATCCTCAGGAGGCTCTGCCGACAATTATTCAGCGAATACGAACCCTCTATCACCCCGGACTTGACAGTGACAAC
AAGGTCAAATTGGCTCGGTTTGCTGAGATTCTTGTTGAGTTTATATCACAGCCATGGGATGCACACACGTCGCCA
CCATTCTTGGTGCTCGAGAGCATAATCCGGCATATTCATTCTCTCGCAAAGTCTTACCCCATCCAAATAGCCCGT
CGATTCCGCCATGAGATTCAGAGCATTGCCCGGACGCGGCCTTTGTCACTGCTTCCATCGGATCTCCTTCTTCTT
ACCGCTGTGGGGACCATATTCCCTACATCTGATCACTTCCACCAAGTTGTTACGCCAGCAATGTTGACCATTGGA
CGATTTCTCGGCCAGCGAGTGCCTCGAAATCTTTCCGACTATGTTTGCGGAACCTATCTCTCTATTCTCGCTCTA
CAGTACCAGCAGCGCTCGAAGCGATATGTCCCTGAGCTCATCAATTTTTGCCTCAACGCCCTTTGCGCGCTATCT
CCCGTACCTCCAAAGAAGAAGCTTGGCAACTTTCCTCAGCATGAACCCCCGACTGGCATTCGATTGAGAAAGGAT
AAAATTCCTGCGCCCAGAAGACTGCGACTGCTCGACTGCATTGCTGCTGACGTCGATGACAAGGAGGCTGTGTCT
GTCAAAATGGCCGTGATCGACACATGTATTCAACTGCTAGACGTGACGGCGGATGTATGGACGGGCAAGAGCGCA
TTTCTAGAGACGCTGCAGCAAGTCATGGGAGTCATCAGGCATTTGATGAGACGGGCTTGTCGGGAATACTTGCCA
AGCCAGACAGGCGAGCGCATAGAAAGGATTCAAGCAAAACTGGAACGCATGATGCGGCTGGCGCAAATGGCACGG
CGCCCGCTCGAACTCCACCACCACCGCCCTCTGGCCATCAAGTCTTACGTGCCCAGGTTTGAGGACTCATTTAAT
CCCGACAAGCATTACGATCCAGACCGTGAGCGGGCCGAGTTGGCCAAGCTGCAAAAGGAGCACAAGAGGGAGCGC
AAGGGAGCAATGCGAGAATTACGCAAAGATGCTCACTTTATGGCGCGAGAGAAGTTGCGCATCAAAAAGGCAAAG
GATGAGGCGTATGAGAAGAAGTTTCAGCGCATCGTATCTGAGATTCAGAGCGAAGAGGGCCGCGAGGCAAATGCG
TACAAAAGGGACATGGAGGCACGGAAGCGGGCGAGAAACAAGTAG
Transcript >OphauG2|6069
ATGGTCGGGTCGCAGCTCAAGCGTCTCAGAGCGTCTTTGCGAGAGCAGGGCATCACCGGGCCTCAGCAGTCAAAG
AAGCAAAAACGCCAACGGGCACAGCATGGTCATGTCGGTAGCGACAAGAGATTGCAGAGAGGCATTGTCTTGCAA
GGCATTCACGAACAGTTCAATCCGTTCGATATCAAGCATGCCGCCAGAGGCCCCAAATTTTCCGTCACAACCAAC
CGGCCGGCCATGGGCGATGCCGCAAAGGGCATCAAAGGCCGGCCTGGCTTGGCCAAAGCAGCCGGCGAAGAAAGA
CGTCGAGAGACATTGCTTGTTGACATGCAACACCGTAACAAGATTGGCGGAATCATTGATCGACGTTTCGGAGAA
AATGATCCCTCAATAGCACCAGAGGAGAAGATGTTGGAACGCTTTGCTCGTGAAAAGCAAGCAAGTCACAAGAAG
AATGCCATTTTCGACTTGGAGGATGACGCGCCTCTCAATGGCGGACTTACGCACATGGGAAAGCCCCTCGTTTTT
GATCAAGATGACGAATCGGCAATCGCAGATGATTTTCGAGAATTTGATTTGGATGAGGACCAAGATAGCGATGAC
TCGGTGCGAGGAACCCAGCGTCTGAAGCGTATGCGTGCCATGGTCTTGAATGGCCAAGACGACGACGAGCCGGAG
CGCAAGAAGACAAAAAAGGAGGTCATGCAGGAAGTCATTGCCAAATCAAAGTTGCACAAGTACGAACGCCAAGCG
GCCAAGGCAGACGATGCTGACTTGCGCGCTGAGCTGGACAAGGGACTTCCGAGCATCAAAATGCTCTTCTCTTTC
AGTGACAAAAACACGGCACATCCAGCCACTGCTGCAGCACTCGCACCGGCCACTACTGGCTCGGTTCACGACGTG
TCGGATAAAGATTACAACTTAAAGGTCAAGCGCTTGGCTCAGGACAAACGAGCACAGCCCACAGAGAGGACCAAG
ACCGAGGAGGAACAGCTAGAAGAAAAGGCAAATATATTGAAAGAGCTGGAAACCAAACGACAAAGACGCATGCTA
GGAGAAGAGGCTTCTGACAGCGATGACGACGAACAAAACGGCCAACAAGAGCGCATGAAAGCACACGCCGTCAAT
GATGATGATGATGACGACGACTTTGGCCTGGGAGGAGGCTTAAAGTCGCGGCCCAGAGCCAAGGATCACGTCTTT
GACGACGAAGATGATTTCATCATTGATGACGGATTAATTGCCAGCGGCTCCGACATTGAGTCAATGGGCCTTGAT
GAGCACGATTCCGACACTGCAGCATGTTTCCCACAAGAAACTCAAACAGACGAAGACGAAGACTTCATTGGAGGC
CTGTTTGGCCAAGAAGAAACCAAAAAAATTGGTTTCAAATCTGTAGCTGCCTCATCAAAAACGGTTTCTGGAGAG
CTGGATGAGCGCGGGCTGCCGTACACCTTTGTTTGCCCGCAATCATGTCAAGAGTTCACGTCTCTCGCAGAGCCC
TATCCTCAGGAGGCTCTGCCGACAATTATTCAGCGAATACGAACCCTCTATCACCCCGGACTTGACAGTGACAAC
AAGGTCAAATTGGCTCGGTTTGCTGAGATTCTTGTTGAGTTTATATCACAGCCATGGGATGCACACACGTCGCCA
CCATTCTTGGTGCTCGAGAGCATAATCCGGCATATTCATTCTCTCGCAAAGTCTTACCCCATCCAAATAGCCCGT
CGATTCCGCCATGAGATTCAGAGCATTGCCCGGACGCGGCCTTTGTCACTGCTTCCATCGGATCTCCTTCTTCTT
ACCGCTGTGGGGACCATATTCCCTACATCTGATCACTTCCACCAAGTTGTTACGCCAGCAATGTTGACCATTGGA
CGATTTCTCGGCCAGCGAGTGCCTCGAAATCTTTCCGACTATGTTTGCGGAACCTATCTCTCTATTCTCGCTCTA
CAGTACCAGCAGCGCTCGAAGCGATATGTCCCTGAGCTCATCAATTTTTGCCTCAACGCCCTTTGCGCGCTATCT
CCCGTACCTCCAAAGAAGAAGCTTGGCAACTTTCCTCAGCATGAACCCCCGACTGGCATTCGATTGAGAAAGGAT
AAAATTCCTGCGCCCAGAAGACTGCGACTGCTCGACTGCATTGCTGCTGACGTCGATGACAAGGAGGCTGTGTCT
GTCAAAATGGCCGTGATCGACACATGTATTCAACTGCTAGACGTGACGGCGGATGTATGGACGGGCAAGAGCGCA
TTTCTAGAGACGCTGCAGCAAGTCATGGGAGTCATCAGGCATTTGATGAGACGGGCTTGTCGGGAATACTTGCCA
AGCCAGACAGGCGAGCGCATAGAAAGGATTCAAGCAAAACTGGAACGCATGATGCGGCTGGCGCAAATGGCACGG
CGCCCGCTCGAACTCCACCACCACCGCCCTCTGGCCATCAAGTCTTACGTGCCCAGGTTTGAGGACTCATTTAAT
CCCGACAAGCATTACGATCCAGACCGTGAGCGGGCCGAGTTGGCCAAGCTGCAAAAGGAGCACAAGAGGGAGCGC
AAGGGAGCAATGCGAGAATTACGCAAAGATGCTCACTTTATGGCGCGAGAGAAGTTGCGCATCAAAAAGGCAAAG
GATGAGGCGTATGAGAAGAAGTTTCAGCGCATCGTATCTGAGATTCAGAGCGAAGAGGGCCGCGAGGCAAATGCG
TACAAAAGGGACATGGAGGCACGGAAGCGGGCGAGAAACAAGTAG
Gene >OphauG2|6069
ATGGTCGGGTCGCAGCTCAAGCGTCTCAGAGCGTCTTTGCGAGAGCAGGGCATCACCGGGCCTCAGCAGTCAAAG
AAGCAAAAACGCCAACGGGCACAGCATGGTCATGTCGGTAGCGACAAGAGATTGCAGAGAGGCATTGTCTTGCAA
GGCATTCACGAACAGTTCAATCCGTTCGATATCAAGCATGCCGCCAGAGGCCCCAAATTTTCCGTCACAACCAAC
CGGCCGGCCATGGGCGATGCCGCAAAGGGCATCAAAGGCCGGCCTGGCTTGGCCAAAGCAGCCGGCGAAGAAAGA
GTGAGCTCACGACCAGCTGAGGGAAACATGACTGGATGGAGACAATACTGACGTTTCTGCCTCAGCGTCGAGAGA
CATTGCTTGTTGACATGCAACACCGTAACAAGATTGGCGGAATCATTGATCGACGTTTCGGAGAAAATGATCCCT
CAATAGCACCAGAGGAGAAGATGTTGGAACGCTTTGCTCGTGAAAAGCAAGCAAGTCACAAGAAGAATGCCATTT
TCGACTTGGAGGATGACGCGCCTCTCAATGGCGGACTTACGCACATGGGAAAGCCCCTCGTTTTTGATCAAGATG
ACGAATCGGCAATCGCAGATGATTTTCGAGAATTTGATTTGGATGAGGACCAAGATAGCGATGACTCGGTGCGAG
GAACCCAGCGTCTGAAGCGTATGCGTGCCATGGTCTTGAATGGCCAAGACGACGACGAGCCGGAGCGCAAGAAGA
CAAAAAAGGAGGTCATGCAGGAAGTCATTGCCAAATCAAAGTTGCACAAGTACGAACGCCAAGCGGCCAAGGCAG
ACGATGCTGACTTGCGCGCTGAGCTGGACAAGGGACTTCCGAGCATCAAAATGCTCTTCTCTTTCAGTGACAAAA
ACACGGCACATCCAGCCACTGCTGCAGCACTCGCACCGGCCACTACTGGCTCGGTTCACGACGTGTCGGATAAAG
ATTACAACTTAAAGGTCAAGCGCTTGGCTCAGGACAAACGAGCACAGCCCACAGAGAGGACCAAGACCGAGGAGG
AACAGCTAGAAGAAAAGGCAAATATATTGAAAGAGCTGGAAACCAAACGACAAAGACGCATGCTAGGAGAAGAGG
CTTCTGACAGCGATGACGACGAACAAAACGGCCAACAAGAGCGCATGAAAGCACACGCCGTCAATGATGATGATG
ATGACGACGACTTTGGCCTGGGAGGAGGCTTAAAGTCGCGGCCCAGAGCCAAGGATCACGTCTTTGACGACGAAG
ATGATTTCATCATTGATGACGGATTAATTGCCAGCGGCTCCGACATTGAGTCAATGGGCCTTGATGAGCACGATT
CCGACACTGCAGCATGTTTCCCACAAGAAACTCAAACAGACGAAGACGAAGACTTCATTGGAGGCCTGTTTGGCC
AAGAAGAAACCAAAAAAATTGGTTTCAAATCTGTAGCTGCCTCATCAAAAACGGTTTCTGGAGAGCTGGATGAGC
GCGGGCTGCCGTACACCTTTGTTTGCCCGCAATCATGTCAAGAGTTCACGTCTCTCGCAGAGCCCTATCCTCAGG
AGGCTCTGCCGACAATTATTCAGCGAATACGAACCCTCTATCACCCCGGACTTGACAGTGACAACAAGGTCAAAT
TGGCTCGGTTTGCTGAGATTCTTGTTGAGTTTATATCACAGCCATGGGATGCACACACGTCGCCACCATTCTTGG
TGCTCGAGAGCATAATCCGGCATATTCATTCTCTCGCAAAGTCTTACCCCATCCAAATAGCCCGTCGATTCCGCC
ATGAGATTCAGAGCATTGCCCGGACGCGGCCTTTGTCACTGCTTCCATCGGATCTCCTTCTTCTTACCGCTGTGG
GGACCATATTCCCTACATCTGATCACTTCCACCAAGTTGTTACGCCAGCAATGTTGACCATTGGACGATTTCTCG
GCCAGCGAGTGCCTCGAAATCTTTCCGACTATGTTTGCGGAACCTATCTCTCTATTCTCGCTCTACAGTACCAGC
AGCGCTCGAAGCGATATGTCCCTGAGCTCATCAATTTTTGCCTCAACGCCCTTTGCGCGCTATCTCCCGTACCTC
CAAAGAAGAAGCTTGGCAACTTTCCTCAGCATGAACCCCCGACTGGCATTCGATTGAGAAAGGATAAAATTCCTG
CGCCCAGAAGACTGCGACTGCTCGACTGCATTGCTGCTGACGTCGATGACAAGGAGGCTGTGTCTGTCAAAATGG
CCGTGATCGACACATGTATTCAACTGCTAGACGTGACGGCGGATGTATGGACGGGCAAGAGCGCATTTCTAGAGA
CGCTGCAGCAAGTCATGGGAGTCATCAGGCATTTGATGAGACGGGCTTGTCGGGAATACTTGCCAAGCCAGACAG
GCGAGCGCATAGAAAGGATTCAAGCAAAACTGGAACGCATGATGCGGCTGGCGCAAATGGCACGGCGCCCGCTCG
AACTCCACCACCACCGCCCTCTGGCCATCAAGTCTTACGTGCCCAGGTTTGAGGACTCATTTAATCCCGACAAGC
ATTACGATCCAGACCGTGAGCGGGCCGAGTTGGCCAAGCTGCAAAAGGAGCACAAGAGGGAGCGCAAGGGAGCAA
TGCGAGAATTACGCAAAGATGCTCACTTTATGGCGCGAGAGAAGTTGCGCATCAAAAAGGCAAAGGATGAGGCGT
ATGAGAAGAAGTTTCAGCGCATCGTATCTGAGATTCAGAGCGAAGAGGGCCGCGAGGCAAATGCGTACAAAAGGG
ACATGGAGGCACGGAAGCGGGCGAGAAACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail