Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6067
Gene name
LocationContig_6:6421..7285
Strand+
Gene length (bp)864
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13821 DUF4187 Domain of unknown function (DUF4187) 3.1E-18 236 286
PF01585 G-patch G-patch domain 1.5E-07 76 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DGZ0|GPT11_DANRE G patch domain-containing protein 11 OS=Danio rerio GN=gpatch11 PE=2 SV=1 9 287 2.0E-19
sp|Q2KI19|GPT11_BOVIN G patch domain-containing protein 11 OS=Bos taurus GN=GPATCH11 PE=2 SV=2 9 287 2.0E-18
sp|Q3UFS4|GPT11_MOUSE G patch domain-containing protein 11 OS=Mus musculus GN=Gpatch11 PE=1 SV=2 9 287 6.0E-17
sp|Q8N954|GPT11_HUMAN G patch domain-containing protein 11 OS=Homo sapiens GN=GPATCH11 PE=1 SV=3 9 287 7.0E-17
sp|Q6DF57|GPT11_XENTR G patch domain-containing protein 11 OS=Xenopus tropicalis GN=gpatch11 PE=2 SV=1 10 287 1.0E-15

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6067
MASSTRDSAEDEDYMNMSFANMDAKAETSLQRTRRLKQEARERGFIKSKAQHQQEAEAARQRGLATSLLDGPGAR
KSKGLAMMAKMGFTGGGLGKAADGTATREPIAISIKDGRGGIGLDSDRKRQRGDDAPGQDALRLKSARRDLDPTD
YRERIGREQQEARREAQFQAAQRLARRLDQDAGTLAYQPVPLLYRGLVRQDQAQHCQPLSSHHQPPDPLDGDAEL
NDDAELDDDAELDAFDALSPADRLSKALQYLRHEHYYCFWCKMAYPTHHLTGCPGLTEEHHD*
Coding >OphauG2|6067
ATGGCGTCAAGCACGCGCGACAGTGCAGAGGATGAGGACTACATGAACATGTCGTTTGCCAACATGGACGCCAAG
GCAGAAACGTCGTTGCAGCGCACTCGGCGGCTCAAGCAAGAGGCGCGTGAACGCGGCTTCATCAAGTCCAAGGCG
CAGCACCAGCAAGAAGCCGAGGCTGCTCGCCAAAGGGGGCTGGCCACCTCTCTTCTCGACGGGCCTGGCGCCCGA
AAAAGCAAGGGCTTGGCCATGATGGCCAAGATGGGCTTTACCGGAGGCGGCCTCGGCAAGGCGGCAGATGGCACA
GCAACCCGCGAGCCCATTGCCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACCGCAAGCGG
CAGCGAGGCGACGACGCTCCAGGCCAAGACGCTCTGCGCCTCAAGAGCGCCAGACGCGACTTGGACCCCACCGAC
TATCGTGAGCGCATCGGTCGCGAGCAGCAAGAGGCGCGGCGCGAAGCCCAGTTCCAAGCGGCCCAGAGACTGGCC
CGGCGCCTGGACCAAGATGCCGGCACTCTGGCCTACCAGCCGGTCCCGCTTCTCTACCGCGGCCTCGTACGCCAA
GACCAGGCCCAGCATTGCCAGCCTCTCTCCTCGCACCACCAGCCCCCAGACCCCCTCGACGGCGATGCCGAGCTC
AACGACGACGCAGAGCTCGACGACGATGCCGAACTCGACGCCTTTGATGCCCTGAGCCCTGCCGACCGCTTATCC
AAGGCTCTACAATACCTTCGACACGAGCACTACTACTGCTTCTGGTGCAAAATGGCTTATCCCACTCACCACCTC
ACCGGATGTCCTGGCCTCACAGAGGAGCATCATGACTGA
Transcript >OphauG2|6067
ATGGCGTCAAGCACGCGCGACAGTGCAGAGGATGAGGACTACATGAACATGTCGTTTGCCAACATGGACGCCAAG
GCAGAAACGTCGTTGCAGCGCACTCGGCGGCTCAAGCAAGAGGCGCGTGAACGCGGCTTCATCAAGTCCAAGGCG
CAGCACCAGCAAGAAGCCGAGGCTGCTCGCCAAAGGGGGCTGGCCACCTCTCTTCTCGACGGGCCTGGCGCCCGA
AAAAGCAAGGGCTTGGCCATGATGGCCAAGATGGGCTTTACCGGAGGCGGCCTCGGCAAGGCGGCAGATGGCACA
GCAACCCGCGAGCCCATTGCCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACCGCAAGCGG
CAGCGAGGCGACGACGCTCCAGGCCAAGACGCTCTGCGCCTCAAGAGCGCCAGACGCGACTTGGACCCCACCGAC
TATCGTGAGCGCATCGGTCGCGAGCAGCAAGAGGCGCGGCGCGAAGCCCAGTTCCAAGCGGCCCAGAGACTGGCC
CGGCGCCTGGACCAAGATGCCGGCACTCTGGCCTACCAGCCGGTCCCGCTTCTCTACCGCGGCCTCGTACGCCAA
GACCAGGCCCAGCATTGCCAGCCTCTCTCCTCGCACCACCAGCCCCCAGACCCCCTCGACGGCGATGCCGAGCTC
AACGACGACGCAGAGCTCGACGACGATGCCGAACTCGACGCCTTTGATGCCCTGAGCCCTGCCGACCGCTTATCC
AAGGCTCTACAATACCTTCGACACGAGCACTACTACTGCTTCTGGTGCAAAATGGCTTATCCCACTCACCACCTC
ACCGGATGTCCTGGCCTCACAGAGGAGCATCATGACTGA
Gene >OphauG2|6067
ATGGCGTCAAGCACGCGCGACAGTGCAGAGGATGAGGACTACATGAACATGTCGTTTGCCAACATGGACGCCAAG
GCAGAAACGTCGTTGCAGCGCACTCGGCGGCTCAAGCAAGAGGCGCGTGAACGCGGCTTCATCAAGTCCAAGGCG
CAGCACCAGCAAGAAGCCGAGGCTGCTCGCCAAAGGGGGCTGGCCACCTCTCTTCTCGACGGGCCTGGCGCCCGA
AAAAGCAAGGGCTTGGCCATGATGGCCAAGATGGGCTTTACCGGAGGCGGCCTCGGCAAGGCGGCAGATGGCACA
GCAACCCGCGAGCCCATTGCCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACCGCAAGCGG
CAGCGAGGCGACGACGCTCCAGGCCAAGACGCTCTGCGCCTCAAGAGCGCCAGACGCGACTTGGACCCCACCGAC
TATCGTGAGCGCATCGGTCGCGAGCAGCAAGAGGCGCGGCGCGAAGCCCAGTTCCAAGCGGCCCAGAGACTGGCC
CGGCGCCTGGACCAAGATGCCGGCACTCTGGCCTACCAGCCGGTCCCGCTTCTCTACCGCGGCCTCGTACGCCAA
GACCAGGCCCAGCATTGCCAGCCTCTCTCCTCGCACCACCAGCCCCCAGACCCCCTCGACGGCGATGCCGAGCTC
AACGACGACGCAGAGCTCGACGACGATGCCGAACTCGACGCCTTTGATGCCCTGAGCCCTGCCGACCGCTTATCC
AAGGCTCTACAATACCTTCGACACGAGCACTACTACTGCTTCTGGTGCAAAATGGCTTATCCCACTCACCACCTC
ACCGGATGTCCTGGCCTCACAGAGGAGCATCATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail