Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6061
Gene name
LocationContig_599:211..1789
Strand+
Gene length (bp)1578
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06221 zf-C2HC5 Putative zinc finger motif, C2HC5-type 2.2E-20 224 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13855|YEX1_SCHPO Uncharacterized protein C1A6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.01c PE=1 SV=3 8 503 2.0E-44
sp|P36119|YK03_YEAST Uncharacterized protein YKR023W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR023W PE=1 SV=1 2 283 3.0E-17
sp|Q9QXN3|TRIP4_MOUSE Activating signal cointegrator 1 OS=Mus musculus GN=Trip4 PE=1 SV=2 222 422 3.0E-16
sp|Q15650|TRIP4_HUMAN Activating signal cointegrator 1 OS=Homo sapiens GN=TRIP4 PE=1 SV=4 222 416 4.0E-15

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0043226 organelle No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043169 cation binding No
GO:0051252 regulation of RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3424
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6061 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2345
Ophiocordyceps camponoti-floridani Ophcf2|00689
Ophiocordyceps camponoti-rufipedis Ophun1|4364
Ophiocordyceps kimflemingae Ophio5|5992
Ophiocordyceps subramaniannii Hirsu2|6465

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6061
MSLAQLSQLLPLPQEELQQILEYAATLSKPDAAVHFSNLLGDSPLAVDFISTFNSRRNQTQPEATPNVDAVPKTK
RGPKKKPAIHTPVARKANEYAGPATTAYSKKTGGLEYIAQQRPSVASSSNASPSATPISRAQTPVKQPLIQQASG
AGYLMSDVPPAKTKSNLSGRNSEAKPSSDKSTKISMTGGTPMKGESTALADLDAAIRALEITTNPTIDGHGARPK
CNCVAARHPLQKAAPNCLSCGKVVCIKEGLGPCTFCGAALLRPEEVQSMIRELKEERGRERMAANAAVHRRPDVS
KTPAPFTQARSESDTKDKLDENWLAEAAARARDHRDKLLSFQAQNARRTVVRDEAADFDVSGAFSGTGSMWASPE
ERAREMKRQQKLMREMEWNALPDYEKRRQVLSIDVVGGKVLRKMAPVERPRTSDTDQEDGSSGEETEATARGGGA
FSRNPLLGALVRPLYGTTDEHQNEHHDEHHDKDTRASQGPGQGSKKWRRVQDDVENNDAIILDGGVQGHAVVAQP
*
Coding >OphauG2|6061
ATGTCTCTAGCACAGCTCTCACAGCTGCTCCCGCTTCCTCAAGAGGAGCTCCAGCAGATACTTGAATATGCTGCA
ACGCTGTCCAAGCCCGATGCTGCCGTTCACTTCAGCAATCTGCTAGGTGACTCGCCACTCGCCGTCGACTTCATC
TCGACCTTTAACTCACGACGAAACCAGACGCAGCCTGAAGCGACGCCAAATGTCGATGCCGTTCCCAAGACCAAA
CGTGGGCCAAAGAAGAAACCAGCTATCCACACGCCCGTGGCCAGAAAGGCAAACGAGTATGCGGGACCAGCAACT
ACCGCCTACAGCAAGAAGACTGGTGGGCTCGAATACATAGCCCAACAGCGTCCTAGTGTGGCGAGCAGCAGCAAT
GCATCGCCGTCAGCCACGCCAATATCCAGAGCTCAGACGCCAGTCAAGCAGCCGCTGATACAACAAGCATCCGGC
GCTGGATATTTGATGTCAGACGTCCCGCCGGCCAAGACCAAGTCAAATCTATCTGGGCGCAACTCAGAAGCAAAG
CCGTCGAGTGACAAGAGCACCAAGATCTCCATGACAGGGGGAACGCCAATGAAGGGGGAATCGACAGCCCTTGCC
GACTTGGACGCTGCCATTCGAGCCTTGGAAATTACCACCAACCCTACAATAGATGGCCATGGTGCAAGGCCCAAG
TGCAACTGTGTGGCGGCTAGACACCCACTACAAAAGGCCGCACCAAATTGCCTGTCTTGCGGCAAGGTTGTCTGT
ATAAAGGAGGGGCTAGGGCCCTGCACGTTTTGTGGTGCAGCCTTACTCAGACCTGAAGAGGTGCAGTCCATGATA
CGAGAGCTCAAGGAGGAGCGAGGGCGAGAGCGAATGGCGGCCAACGCCGCTGTGCACCGCCGACCAGACGTATCC
AAAACGCCAGCACCTTTTACACAAGCGCGGAGTGAGAGCGATACCAAGGACAAACTAGACGAGAATTGGCTAGCC
GAGGCTGCAGCGCGCGCGCGAGACCACAGGGACAAATTGCTGAGCTTCCAAGCCCAGAACGCTCGACGTACAGTT
GTGCGAGACGAGGCGGCTGATTTTGACGTGAGTGGCGCCTTTTCCGGCACGGGTAGCATGTGGGCCAGCCCCGAG
GAGAGAGCCAGGGAAATGAAGCGGCAGCAGAAGCTCATGCGCGAAATGGAGTGGAATGCACTACCAGACTATGAG
AAGCGAAGGCAGGTGCTCAGCATTGATGTCGTGGGAGGCAAAGTGCTTCGCAAAATGGCGCCGGTTGAGCGGCCC
AGGACAAGCGACACGGACCAAGAGGACGGCAGTAGTGGAGAAGAAACGGAGGCGACAGCGAGGGGAGGCGGAGCA
TTCAGTCGCAATCCTCTGCTGGGTGCCTTGGTGAGGCCTTTGTATGGGACGACGGATGAGCACCAGAATGAGCAC
CACGACGAGCACCACGACAAGGACACTAGGGCAAGTCAAGGTCCTGGACAAGGGAGCAAGAAATGGCGGCGGGTC
CAGGATGATGTTGAAAACAACGACGCCATCATTTTAGACGGGGGAGTCCAAGGCCACGCAGTGGTGGCGCAGCCG
TAA
Transcript >OphauG2|6061
ATGTCTCTAGCACAGCTCTCACAGCTGCTCCCGCTTCCTCAAGAGGAGCTCCAGCAGATACTTGAATATGCTGCA
ACGCTGTCCAAGCCCGATGCTGCCGTTCACTTCAGCAATCTGCTAGGTGACTCGCCACTCGCCGTCGACTTCATC
TCGACCTTTAACTCACGACGAAACCAGACGCAGCCTGAAGCGACGCCAAATGTCGATGCCGTTCCCAAGACCAAA
CGTGGGCCAAAGAAGAAACCAGCTATCCACACGCCCGTGGCCAGAAAGGCAAACGAGTATGCGGGACCAGCAACT
ACCGCCTACAGCAAGAAGACTGGTGGGCTCGAATACATAGCCCAACAGCGTCCTAGTGTGGCGAGCAGCAGCAAT
GCATCGCCGTCAGCCACGCCAATATCCAGAGCTCAGACGCCAGTCAAGCAGCCGCTGATACAACAAGCATCCGGC
GCTGGATATTTGATGTCAGACGTCCCGCCGGCCAAGACCAAGTCAAATCTATCTGGGCGCAACTCAGAAGCAAAG
CCGTCGAGTGACAAGAGCACCAAGATCTCCATGACAGGGGGAACGCCAATGAAGGGGGAATCGACAGCCCTTGCC
GACTTGGACGCTGCCATTCGAGCCTTGGAAATTACCACCAACCCTACAATAGATGGCCATGGTGCAAGGCCCAAG
TGCAACTGTGTGGCGGCTAGACACCCACTACAAAAGGCCGCACCAAATTGCCTGTCTTGCGGCAAGGTTGTCTGT
ATAAAGGAGGGGCTAGGGCCCTGCACGTTTTGTGGTGCAGCCTTACTCAGACCTGAAGAGGTGCAGTCCATGATA
CGAGAGCTCAAGGAGGAGCGAGGGCGAGAGCGAATGGCGGCCAACGCCGCTGTGCACCGCCGACCAGACGTATCC
AAAACGCCAGCACCTTTTACACAAGCGCGGAGTGAGAGCGATACCAAGGACAAACTAGACGAGAATTGGCTAGCC
GAGGCTGCAGCGCGCGCGCGAGACCACAGGGACAAATTGCTGAGCTTCCAAGCCCAGAACGCTCGACGTACAGTT
GTGCGAGACGAGGCGGCTGATTTTGACGTGAGTGGCGCCTTTTCCGGCACGGGTAGCATGTGGGCCAGCCCCGAG
GAGAGAGCCAGGGAAATGAAGCGGCAGCAGAAGCTCATGCGCGAAATGGAGTGGAATGCACTACCAGACTATGAG
AAGCGAAGGCAGGTGCTCAGCATTGATGTCGTGGGAGGCAAAGTGCTTCGCAAAATGGCGCCGGTTGAGCGGCCC
AGGACAAGCGACACGGACCAAGAGGACGGCAGTAGTGGAGAAGAAACGGAGGCGACAGCGAGGGGAGGCGGAGCA
TTCAGTCGCAATCCTCTGCTGGGTGCCTTGGTGAGGCCTTTGTATGGGACGACGGATGAGCACCAGAATGAGCAC
CACGACGAGCACCACGACAAGGACACTAGGGCAAGTCAAGGTCCTGGACAAGGGAGCAAGAAATGGCGGCGGGTC
CAGGATGATGTTGAAAACAACGACGCCATCATTTTAGACGGGGGAGTCCAAGGCCACGCAGTGGTGGCGCAGCCG
TAA
Gene >OphauG2|6061
ATGTCTCTAGCACAGCTCTCACAGCTGCTCCCGCTTCCTCAAGAGGAGCTCCAGCAGATACTTGAATATGCTGCA
ACGCTGTCCAAGCCCGATGCTGCCGTTCACTTCAGCAATCTGCTAGGTGACTCGCCACTCGCCGTCGACTTCATC
TCGACCTTTAACTCACGACGAAACCAGACGCAGCCTGAAGCGACGCCAAATGTCGATGCCGTTCCCAAGACCAAA
CGTGGGCCAAAGAAGAAACCAGCTATCCACACGCCCGTGGCCAGAAAGGCAAACGAGTATGCGGGACCAGCAACT
ACCGCCTACAGCAAGAAGACTGGTGGGCTCGAATACATAGCCCAACAGCGTCCTAGTGTGGCGAGCAGCAGCAAT
GCATCGCCGTCAGCCACGCCAATATCCAGAGCTCAGACGCCAGTCAAGCAGCCGCTGATACAACAAGCATCCGGC
GCTGGATATTTGATGTCAGACGTCCCGCCGGCCAAGACCAAGTCAAATCTATCTGGGCGCAACTCAGAAGCAAAG
CCGTCGAGTGACAAGAGCACCAAGATCTCCATGACAGGGGGAACGCCAATGAAGGGGGAATCGACAGCCCTTGCC
GACTTGGACGCTGCCATTCGAGCCTTGGAAATTACCACCAACCCTACAATAGATGGCCATGGTGCAAGGCCCAAG
TGCAACTGTGTGGCGGCTAGACACCCACTACAAAAGGCCGCACCAAATTGCCTGTCTTGCGGCAAGGTTGTCTGT
ATAAAGGAGGGGCTAGGGCCCTGCACGTTTTGTGGTGCAGCCTTACTCAGACCTGAAGAGGTGCAGTCCATGATA
CGAGAGCTCAAGGAGGAGCGAGGGCGAGAGCGAATGGCGGCCAACGCCGCTGTGCACCGCCGACCAGACGTATCC
AAAACGCCAGCACCTTTTACACAAGCGCGGAGTGAGAGCGATACCAAGGACAAACTAGACGAGAATTGGCTAGCC
GAGGCTGCAGCGCGCGCGCGAGACCACAGGGACAAATTGCTGAGCTTCCAAGCCCAGAACGCTCGACGTACAGTT
GTGCGAGACGAGGCGGCTGATTTTGACGTGAGTGGCGCCTTTTCCGGCACGGGTAGCATGTGGGCCAGCCCCGAG
GAGAGAGCCAGGGAAATGAAGCGGCAGCAGAAGCTCATGCGCGAAATGGAGTGGAATGCACTACCAGACTATGAG
AAGCGAAGGCAGGTGCTCAGCATTGATGTCGTGGGAGGCAAAGTGCTTCGCAAAATGGCGCCGGTTGAGCGGCCC
AGGACAAGCGACACGGACCAAGAGGACGGCAGTAGTGGAGAAGAAACGGAGGCGACAGCGAGGGGAGGCGGAGCA
TTCAGTCGCAATCCTCTGCTGGGTGCCTTGGTGAGGCCTTTGTATGGGACGACGGATGAGCACCAGAATGAGCAC
CACGACGAGCACCACGACAAGGACACTAGGGCAAGTCAAGGTCCTGGACAAGGGAGCAAGAAATGGCGGCGGGTC
CAGGATGATGTTGAAAACAACGACGCCATCATTTTAGACGGGGGAGTCCAAGGCCACGCAGTGGTGGCGCAGCCG
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail