Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6057
Gene name
LocationContig_598:308..2922
Strand-
Gene length (bp)2614
Transcript length (bp)2337
Coding sequence length (bp)2337
Protein length (aa) 779

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 2.8E-30 433 737
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 9.5E-24 10 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 3 771 6.0E-137
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 27 755 5.0E-76
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 27 755 1.0E-75
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 340 747 2.0E-74
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 27 755 1.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 3 771 6.0E-137
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 27 755 5.0E-76
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 27 755 1.0E-75
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 340 747 2.0E-74
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 27 755 1.0E-72
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 27 755 1.0E-71
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 28 755 1.0E-59
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 26 726 1.0E-57
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 5 768 1.0E-55
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 346 747 2.0E-37
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 354 743 4.0E-34
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 355 748 7.0E-28
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 354 726 1.0E-27
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 8 94 3.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup638
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2313
Ophiocordyceps australis 1348a (Ghana) OphauG2|6057 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6914
Ophiocordyceps camponoti-floridani Ophcf2|05674
Ophiocordyceps camponoti-rufipedis Ophun1|5020
Ophiocordyceps kimflemingae Ophio5|6255
Ophiocordyceps subramaniannii Hirsu2|10433
Ophiocordyceps subramaniannii Hirsu2|10434

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6057
MPKPSHRAQLAQLKALKQSGKKTFDVYQVDNAQDVYDEVDEDGYKKIVRNRLDQDDFVVDDNGEGYADDGREEWD
QVERHEDSGDSDAAPRAKRSKGGRVRDAKDDAVQEQAKRDATDRSISDYFGARGANKAQPKVKVAQTQDEVDFMA
GILDDVDSAAGLAAPTQARRGGWNERRKSRGLSPAPQREAKRQKRLDRRASSPQAPIKADYDGDGFLTPLDEDED
VVMDHAMTVAEPKVQMKQEAWQEDGVKDGDQEKDKMKEEQEDDGGMIEVAHAGAVEARSVNLTAIRPAQETVKAE
SRTTKTEEDEAIDASSWTQVTEKLKVASSSPVESRGIGKVDGKDVMEDDGSVKFFWIDFTEVNGSLCLFGKVLEK
KSKAYVSALVKIDNIQRKLYFLPRGRGVLGEGEGEGEGEGEGEGEGEGEGEGEENGNEADMMDVCSEVDRLMSDM
KVPVYKMKRCTRKYAFELGEIPREAEYLKLLYPYTQPMMDMDTKGKTFSHVFGTNTALFEQFVVWRKIMGPCWLR
IGQANSEALKNASHCKVELVVDKPESVSAMSDGEGLEAPPLTLMSVALRTVWKASDNRHEVFAISGRIYQDVQLS
DTTPADKRPSRSFTVLRPGGTGFPVGFEQLARERGRGLIASKRSEAEVLAFFLAQVQLADPDVLLGHQLEGVDLS
ILLRRLHETKVPQWSRLGRLRRSHWPWTVGKGGAASAVGERQVLAGRLLCDLANEAGRAVLSRCQTWALGEMCSL
YLGSDVRRRDRPTPTTLPPWSWASSCCR*
Coding >OphauG2|6057
ATGCCCAAGCCCTCTCACCGAGCCCAGCTGGCCCAGCTCAAGGCTCTCAAGCAATCGGGCAAGAAGACTTTTGAC
GTTTACCAAGTGGACAATGCGCAAGACGTCTACGACGAAGTGGACGAGGATGGATACAAGAAGATTGTGCGTAAT
CGGCTAGACCAAGATGACTTTGTTGTCGATGACAATGGCGAGGGATACGCCGATGATGGGCGCGAGGAGTGGGAC
CAAGTCGAGCGACATGAAGACTCTGGCGACAGCGACGCGGCGCCAAGGGCCAAGCGAAGCAAAGGCGGTAGAGTT
AGAGATGCAAAAGACGATGCTGTGCAAGAGCAGGCAAAACGAGACGCCACCGACCGCTCCATCAGTGACTACTTT
GGCGCAAGAGGGGCGAACAAGGCACAGCCAAAAGTCAAGGTTGCGCAGACGCAGGACGAGGTCGATTTCATGGCG
GGCATACTTGACGACGTCGACTCGGCTGCTGGCTTGGCAGCACCGACTCAAGCTCGACGCGGCGGATGGAACGAG
CGTCGCAAGTCAAGAGGCCTTTCACCTGCCCCTCAAAGAGAAGCCAAGAGGCAGAAGCGGCTTGACAGGCGCGCC
TCGTCGCCGCAAGCGCCCATCAAGGCGGATTATGACGGCGATGGCTTTTTGACGCCATTGGACGAAGATGAAGAT
GTTGTCATGGACCATGCCATGACTGTTGCCGAGCCAAAGGTGCAGATGAAGCAAGAGGCTTGGCAGGAGGATGGA
GTCAAAGACGGAGACCAAGAAAAGGACAAGATGAAGGAGGAGCAAGAGGATGATGGGGGCATGATTGAGGTTGCC
CATGCAGGCGCGGTGGAAGCGCGCAGCGTCAATCTAACAGCCATTCGCCCGGCACAAGAAACTGTCAAAGCCGAA
TCGCGTACAACAAAGACGGAAGAAGACGAGGCCATTGACGCCTCGTCATGGACCCAAGTGACGGAGAAGCTCAAG
GTGGCAAGCAGCAGTCCTGTTGAATCAAGAGGCATAGGCAAAGTGGATGGCAAGGACGTCATGGAAGACGATGGC
AGCGTCAAGTTTTTCTGGATCGATTTTACCGAGGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTTCTGGAAAAG
AAGAGCAAGGCGTACGTGAGTGCTTTGGTCAAGATTGACAATATCCAGCGAAAGCTCTACTTTTTGCCGCGGGGG
CGAGGGGTGTTGGGCGAGGGTGAGGGTGAGGGTGAGGGTGAGGGCGAGGGCGAGGGCGAGGGCGAGGGCGAGGGC
GAGGGCGAGGAGAATGGAAACGAGGCGGACATGATGGACGTGTGCAGCGAAGTGGACAGGTTGATGAGCGACATG
AAGGTGCCCGTGTACAAGATGAAGAGGTGTACGCGCAAGTATGCGTTTGAGCTGGGCGAGATTCCCAGAGAGGCC
GAGTATCTGAAGCTCTTGTACCCATATACGCAGCCCATGATGGACATGGATACCAAGGGCAAAACGTTTAGCCAC
GTCTTTGGCACCAACACGGCCCTCTTTGAGCAGTTTGTCGTGTGGCGCAAAATCATGGGCCCCTGCTGGCTGAGG
ATAGGGCAAGCCAATAGCGAGGCACTCAAAAACGCATCGCACTGCAAGGTGGAGCTTGTGGTGGACAAGCCCGAG
TCGGTGTCGGCCATGAGCGACGGCGAGGGACTCGAGGCGCCGCCGCTGACGCTCATGAGCGTGGCGCTGAGGACG
GTGTGGAAGGCGAGCGACAATAGGCACGAGGTGTTTGCCATTAGTGGGCGCATCTACCAAGACGTGCAGCTGAGC
GACACGACGCCAGCAGACAAGCGGCCCAGCCGAAGCTTCACGGTGCTGCGGCCGGGCGGGACAGGCTTCCCGGTT
GGCTTTGAGCAGCTGGCCAGGGAGCGAGGGCGCGGGCTGATTGCAAGCAAGCGGAGCGAGGCAGAGGTGCTGGCC
TTTTTCCTGGCGCAGGTGCAGCTTGCGGATCCCGATGTGCTGCTGGGCCACCAGCTCGAGGGCGTGGACCTGAGC
ATCCTGCTGCGGCGCCTGCACGAGACAAAGGTGCCGCAGTGGTCGCGTCTGGGCCGGCTGCGGCGCTCCCACTGG
CCCTGGACAGTGGGCAAAGGCGGGGCCGCCAGCGCAGTGGGCGAGCGCCAGGTCCTGGCTGGCCGGCTGCTGTGC
GACCTGGCCAACGAGGCGGGGCGCGCAGTGCTGTCGCGCTGCCAGACCTGGGCGCTGGGCGAAATGTGCAGCCTG
TACCTGGGCAGCGACGTGCGCCGCCGCGACAGGCCGACACCCACTACATTGCCGCCCTGGTCCTGGGCGTCCAGC
TGCTGCCGCTGA
Transcript >OphauG2|6057
ATGCCCAAGCCCTCTCACCGAGCCCAGCTGGCCCAGCTCAAGGCTCTCAAGCAATCGGGCAAGAAGACTTTTGAC
GTTTACCAAGTGGACAATGCGCAAGACGTCTACGACGAAGTGGACGAGGATGGATACAAGAAGATTGTGCGTAAT
CGGCTAGACCAAGATGACTTTGTTGTCGATGACAATGGCGAGGGATACGCCGATGATGGGCGCGAGGAGTGGGAC
CAAGTCGAGCGACATGAAGACTCTGGCGACAGCGACGCGGCGCCAAGGGCCAAGCGAAGCAAAGGCGGTAGAGTT
AGAGATGCAAAAGACGATGCTGTGCAAGAGCAGGCAAAACGAGACGCCACCGACCGCTCCATCAGTGACTACTTT
GGCGCAAGAGGGGCGAACAAGGCACAGCCAAAAGTCAAGGTTGCGCAGACGCAGGACGAGGTCGATTTCATGGCG
GGCATACTTGACGACGTCGACTCGGCTGCTGGCTTGGCAGCACCGACTCAAGCTCGACGCGGCGGATGGAACGAG
CGTCGCAAGTCAAGAGGCCTTTCACCTGCCCCTCAAAGAGAAGCCAAGAGGCAGAAGCGGCTTGACAGGCGCGCC
TCGTCGCCGCAAGCGCCCATCAAGGCGGATTATGACGGCGATGGCTTTTTGACGCCATTGGACGAAGATGAAGAT
GTTGTCATGGACCATGCCATGACTGTTGCCGAGCCAAAGGTGCAGATGAAGCAAGAGGCTTGGCAGGAGGATGGA
GTCAAAGACGGAGACCAAGAAAAGGACAAGATGAAGGAGGAGCAAGAGGATGATGGGGGCATGATTGAGGTTGCC
CATGCAGGCGCGGTGGAAGCGCGCAGCGTCAATCTAACAGCCATTCGCCCGGCACAAGAAACTGTCAAAGCCGAA
TCGCGTACAACAAAGACGGAAGAAGACGAGGCCATTGACGCCTCGTCATGGACCCAAGTGACGGAGAAGCTCAAG
GTGGCAAGCAGCAGTCCTGTTGAATCAAGAGGCATAGGCAAAGTGGATGGCAAGGACGTCATGGAAGACGATGGC
AGCGTCAAGTTTTTCTGGATCGATTTTACCGAGGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTTCTGGAAAAG
AAGAGCAAGGCGTACGTGAGTGCTTTGGTCAAGATTGACAATATCCAGCGAAAGCTCTACTTTTTGCCGCGGGGG
CGAGGGGTGTTGGGCGAGGGTGAGGGTGAGGGTGAGGGTGAGGGCGAGGGCGAGGGCGAGGGCGAGGGCGAGGGC
GAGGGCGAGGAGAATGGAAACGAGGCGGACATGATGGACGTGTGCAGCGAAGTGGACAGGTTGATGAGCGACATG
AAGGTGCCCGTGTACAAGATGAAGAGGTGTACGCGCAAGTATGCGTTTGAGCTGGGCGAGATTCCCAGAGAGGCC
GAGTATCTGAAGCTCTTGTACCCATATACGCAGCCCATGATGGACATGGATACCAAGGGCAAAACGTTTAGCCAC
GTCTTTGGCACCAACACGGCCCTCTTTGAGCAGTTTGTCGTGTGGCGCAAAATCATGGGCCCCTGCTGGCTGAGG
ATAGGGCAAGCCAATAGCGAGGCACTCAAAAACGCATCGCACTGCAAGGTGGAGCTTGTGGTGGACAAGCCCGAG
TCGGTGTCGGCCATGAGCGACGGCGAGGGACTCGAGGCGCCGCCGCTGACGCTCATGAGCGTGGCGCTGAGGACG
GTGTGGAAGGCGAGCGACAATAGGCACGAGGTGTTTGCCATTAGTGGGCGCATCTACCAAGACGTGCAGCTGAGC
GACACGACGCCAGCAGACAAGCGGCCCAGCCGAAGCTTCACGGTGCTGCGGCCGGGCGGGACAGGCTTCCCGGTT
GGCTTTGAGCAGCTGGCCAGGGAGCGAGGGCGCGGGCTGATTGCAAGCAAGCGGAGCGAGGCAGAGGTGCTGGCC
TTTTTCCTGGCGCAGGTGCAGCTTGCGGATCCCGATGTGCTGCTGGGCCACCAGCTCGAGGGCGTGGACCTGAGC
ATCCTGCTGCGGCGCCTGCACGAGACAAAGGTGCCGCAGTGGTCGCGTCTGGGCCGGCTGCGGCGCTCCCACTGG
CCCTGGACAGTGGGCAAAGGCGGGGCCGCCAGCGCAGTGGGCGAGCGCCAGGTCCTGGCTGGCCGGCTGCTGTGC
GACCTGGCCAACGAGGCGGGGCGCGCAGTGCTGTCGCGCTGCCAGACCTGGGCGCTGGGCGAAATGTGCAGCCTG
TACCTGGGCAGCGACGTGCGCCGCCGCGACAGGCCGACACCCACTACATTGCCGCCCTGGTCCTGGGCGTCCAGC
TGCTGCCGCTGA
Gene >OphauG2|6057
ATGCCCAAGCCCTCTCACCGAGCCCAGCTGGCCCAGCTCAAGGCTCTCAAGCAATCGGGCAAGAAGACTTTTGAC
GTTTACCAAGTGGACAATGCGCAAGACGTCTACGACGAAGTGGACGAGGATGGATACAAGAAGATTGTGCGTAAT
CGGCTAGACCAAGATGACTTTGTTGTCGATGACAATGGCGAGGGATACGCCGATGATGGGCGCGAGGAGTGGGAC
CAAGTCGAGCGACATGAAGACTCTGGCGACAGCGACGCGGCGCCAAGGGCCAAGCGAAGCAAAGGCGGTAGAGTT
AGAGATGGTTTGTTGGAGCCGGGACCACGTTGACGGATGCGGCACGGGCTGACAAGTCGGCGTAGCAAAAGACGA
TGCTGTGCAAGAGCAGGCAAAACGAGACGCCACCGACCGCTCCATCAGTGACTACTTTGGCGCAAGAGGGGCGAA
CAAGGCACAGCCAAAAGTCAAGGTAGTCTCTTTTGCCGTTTGGCGCCTTGGGGAACATGTGACTCACTGGATTGT
AATGCAGGTTGCGCAGACGCAGGACGAGGTCGATTTCATGGCGGGCATACTTGACGACGTCGACTCGGCTGCTGG
CTTGGCAGCACCGACTCAAGCTCGACGCGGCGGATGGAACGAGCGTCGCAAGTCAAGAGGCCTTTCACCTGCCCC
TCAAAGAGAAGCCAAGAGGCAGAAGCGGCTTGACAGGCGCGCCTCGTCGCCGCAAGCGCCCATCAAGGCGGATTA
TGACGGCGATGGCTTTTTGACGCCATTGGACGAAGATGAAGATGTTGTCATGGACCATGCCATGACTGTTGCCGA
GCCAAAGGTGCAGATGAAGCAAGAGGCTTGGCAGGAGGATGGAGTCAAAGACGGAGACCAAGAAAAGGACAAGAT
GAAGGAGGAGCAAGAGGATGATGGGGGCATGATTGAGGTTGCCCATGCAGGCGCGGTGGAAGCGCGCAGCGTCAA
TCTAACAGCCATTCGCCCGGCACAAGAAACTGTCAAAGCCGAATCGCGTACAACAAAGACGGAAGAAGACGAGGC
CATTGACGCCTCGTCATGGACCCAAGTGACGGAGAAGCTCAAGGTGGCAAGCAGCAGTCCTGTTGAATCAAGAGG
CATAGGCAAAGTGGATGGCAAGGACGTCATGGAAGACGATGGCAGCGTCAAGTTTTTCTGGATCGATTTTACCGA
GGTCAATGGCAGCCTGTGCCTGTTTGGCAAGGTTCTGGAAAAGAAGAGCAAGGCGTACGTGAGTGCTTTGGTCAA
GATTGACAATATCCAGCGAAAGCTCTACTTTTTGCCGCGGGGGCGAGGGGTGTTGGGCGAGGGTGAGGGTGAGGG
TGAGGGTGAGGGCGAGGGCGAGGGCGAGGGCGAGGGCGAGGGCGAGGGCGAGGAGAATGGAAACGAGGCGGACAT
GATGGACGTGTGCAGCGAAGTGGACAGGTTGATGAGCGACATGAAGGTGCCCGTGTACAAGATGAAGAGGTGTAC
GCGCAAGTATGCGTTTGAGCTGGGCGAGATTCCCAGAGAGGCCGAGTATCTGAAGCTCTTGTACCCATATACGCG
TGAGTGGTTGGCCTCTTTTTCTCTTGTCTTGGACTGTCATGGCGACTGTCATGGCGACTGTCAACTACTTGCTAA
CGGCAAACAGAGCCCATGATGGACATGGATACCAAGGGCAAAACGTTTAGCCACGTCTTTGGCACCAACACGGCC
CTCTTTGAGCAGTTTGTCGTGTGGCGCAAAATCATGGGCCCCTGCTGGCTGAGGATAGGGCAAGCCAATAGCGAG
GCACTCAAAAACGCATCGCACTGCAAGGTGGAGCTTGTGGTGGACAAGCCCGAGTCGGTGTCGGCCATGAGCGAC
GGCGAGGGACTCGAGGCGCCGCCGCTGACGCTCATGAGCGTGGCGCTGAGGACGGTGTGGAAGGCGAGCGACAAT
AGGCACGAGGTGTTTGCCATTAGTGGGCGCATCTACCAAGACGTGCAGCTGAGCGACACGACGCCAGCAGACAAG
CGGCCCAGCCGAAGCTTCACGGTGCTGCGGCCGGGCGGGACAGGCTTCCCGGTTGGCTTTGAGCAGCTGGCCAGG
GAGCGAGGGCGCGGGCTGATTGCAAGCAAGCGGAGCGAGGCAGAGGTGCTGGCCTTTTTCCTGGCGCAGGTGCAG
CTTGCGGATCCCGATGTGCTGCTGGGCCACCAGCTCGAGGGCGTGGACCTGAGCATCCTGCTGCGGCGCCTGCAC
GAGACAAAGGTGCCGCAGTGGTCGCGTCTGGGCCGGCTGCGGCGCTCCCACTGGCCCTGGACAGTGGGCAAAGGC
GGGGCCGCCAGCGCAGTGGGCGAGCGCCAGGTCCTGGCTGGCCGGCTGCTGTGCGACCTGGCCAACGAGGCGGGG
CGCGCAGTGCTGTCGCGCTGCCAGACCTGGGCGCTGGGCGAAATGTGCAGCCTGTACCTGGGCAGCGACGTGCGC
CGCCGCGACGTGGACACGGCCGCTGCTCTGGGCTCCTGGGCCGCCCACCGCCAGGGCTTGCTGGACCTGATTGGC
CACGCAGAGGCCGACACCCACTACATTGCCGCCCTGGTCCTGGGCGTCCAGCTGCTGCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail