Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6056
Gene name
LocationContig_597:9867..10774
Strand+
Gene length (bp)907
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6056 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2744
Ophiocordyceps camponoti-floridani Ophcf2|04024
Ophiocordyceps camponoti-rufipedis Ophun1|1970
Ophiocordyceps kimflemingae Ophio5|5847
Ophiocordyceps subramaniannii Hirsu2|3579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6056
MLTILPVRDFPSLSNNSQLNASQATMWSNAGSRNLSGPVQRNQSTPVSGPTAGQDDLFAATSSRMPPHQGSFRSR
GPESKSAACQSFLASLECPSPLVRAGFGPQNPSSTHVQSHRGNGLLNALSANNRANEARTPPGVSTSDSPRGGQE
GKRADESRLKPLSFRDGNMSRSTHVAADSSAQATDGRTHLGAIGNEGSVAKSKDDKVNQLPESVDPLSGMAAVDK
WGIKGLRTLMNNHPDFHAMVVGMDPNTLGLDLSNQE*
Coding >OphauG2|6056
ATGCTGACCATTCTTCCTGTCAGAGACTTTCCGTCATTGTCCAACAACTCGCAGCTCAATGCTAGCCAAGCTACA
ATGTGGTCAAATGCAGGATCCAGAAATCTAAGCGGTCCTGTACAGCGCAACCAATCCACGCCTGTATCAGGTCCA
ACAGCTGGGCAAGATGATCTCTTTGCTGCTACATCGTCGCGCATGCCACCTCATCAAGGTTCGTTCCGCTCAAGG
GGCCCCGAAAGCAAGTCAGCCGCCTGTCAGAGCTTCCTGGCTAGTCTCGAGTGCCCGTCTCCCCTTGTCCGCGCC
GGATTTGGTCCTCAAAATCCGAGCTCAACTCATGTGCAATCTCATCGAGGCAACGGCTTGTTGAATGCCCTGTCG
GCAAATAACCGGGCTAATGAGGCGCGAACACCTCCTGGAGTATCAACCTCAGATTCACCTCGTGGAGGGCAAGAG
GGAAAGCGAGCAGATGAGTCAAGACTGAAGCCGTTATCCTTTCGAGACGGAAATATGAGCAGATCTACACACGTG
GCAGCCGATAGTTCAGCACAAGCAACAGACGGCCGGACCCACTTGGGTGCTATAGGAAACGAAGGCTCCGTGGCC
AAGTCCAAAGACGACAAGGTCAATCAACTTCCCGAGTCTGTTGACCCCCTGTCAGGAATGGCTGCGGTGGACAAG
TGGGGCATCAAAGGTCTACGGACCCTGATGAACAACCACCCCGATTTTCACGCCATGGTAGTGGGCATGGATCCC
AATACTCTGGGACTTGATTTGAGCAATCAGGAGTAA
Transcript >OphauG2|6056
ATGCTGACCATTCTTCCTGTCAGAGACTTTCCGTCATTGTCCAACAACTCGCAGCTCAATGCTAGCCAAGCTACA
ATGTGGTCAAATGCAGGATCCAGAAATCTAAGCGGTCCTGTACAGCGCAACCAATCCACGCCTGTATCAGGTCCA
ACAGCTGGGCAAGATGATCTCTTTGCTGCTACATCGTCGCGCATGCCACCTCATCAAGGTTCGTTCCGCTCAAGG
GGCCCCGAAAGCAAGTCAGCCGCCTGTCAGAGCTTCCTGGCTAGTCTCGAGTGCCCGTCTCCCCTTGTCCGCGCC
GGATTTGGTCCTCAAAATCCGAGCTCAACTCATGTGCAATCTCATCGAGGCAACGGCTTGTTGAATGCCCTGTCG
GCAAATAACCGGGCTAATGAGGCGCGAACACCTCCTGGAGTATCAACCTCAGATTCACCTCGTGGAGGGCAAGAG
GGAAAGCGAGCAGATGAGTCAAGACTGAAGCCGTTATCCTTTCGAGACGGAAATATGAGCAGATCTACACACGTG
GCAGCCGATAGTTCAGCACAAGCAACAGACGGCCGGACCCACTTGGGTGCTATAGGAAACGAAGGCTCCGTGGCC
AAGTCCAAAGACGACAAGGTCAATCAACTTCCCGAGTCTGTTGACCCCCTGTCAGGAATGGCTGCGGTGGACAAG
TGGGGCATCAAAGGTCTACGGACCCTGATGAACAACCACCCCGATTTTCACGCCATGGTAGTGGGCATGGATCCC
AATACTCTGGGACTTGATTTGAGCAATCAGGAGTAA
Gene >OphauG2|6056
ATGCTGACCATTCTTCCTGTCAGAGACTTTCCGTCATTGTCCAACAACTCGCAGCTCAATGCTAGCCAAGCTACA
ATGTGGTCAAATGCAGGATCCAGAAATCTAAGCGGTCCTGTACAGCGCAACCAATCCACGCCTGTATCAGGTCCA
ACAGCTGGGCAAGATGATCTCTTTGCTGCTACATCGTCGCGCATGCCACCTCATCAAGGTTCGTTCCGCTCAAGG
GGCCCCGAAAGCAAGTCAGCCGCCTGTCAGAGCTTCCTGGCTAGTCTCGAGTGCCCGTCTCCCCTTGTCCGCGCC
GGTCCCCCAGAGGCGTTTTTGCAAGCCACAGATAAGCCCATCTGACATGTTGCTCTCTAGGATTTGGTCCTCAAA
ATCCGAGCTCAACTCATGTGCAATCTCATCGAGGCAACGGCTTGTTGAATGCCCTGTCGGCAAATAACCGGGCTA
ATGAGGCGCGAACACCTCCTGGAGTATCAACCTCAGGTATTTTGAACCTTGATCTGGGATCCATGGTCAGACTAG
GAATACTATTGACACGCAAACAGATTCACCTCGTGGAGGGCAAGAGGGAAAGCGAGCAGATGAGTCAAGACTGAA
GCCGTTATCCTTTCGAGACGGAAATATGAGCAGATCTACACACGTGGCAGCCGATAGTTCAGCACAAGCAACAGA
CGGCCGGACCCACTTGGGTGCTATAGGAAACGAAGGCTCCGTGGCCAAGTCCAAAGACGACAAGGTCAATCAACT
TCCCGAGTCTGTTGACCCCCTGTCAGGAATGGCTGCGGTGGACAAGTGGGGCATCAAAGGTCTACGGACCCTGAT
GAACAACCACCCCGATTTTCACGCCATGGTAGTGGGCATGGATCCCAATACTCTGGGACTTGATTTGAGCAATCA
GGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail