Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6048
Gene name
LocationContig_595:9786..11663
Strand-
Gene length (bp)1877
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 8.1E-18 7 73
PF13516 LRR_6 Leucine Rich repeat 3.5E-01 313 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBD9|TBCE_PONAB Tubulin-specific chaperone E OS=Pongo abelii GN=TBCE PE=2 SV=1 7 498 3.0E-58
sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens GN=TBCE PE=1 SV=1 7 498 9.0E-58
sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 7 500 2.0E-57
sp|Q5FVQ9|TBCE_RAT Tubulin-specific chaperone E OS=Rattus norvegicus GN=Tbce PE=2 SV=1 7 500 3.0E-57
sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus GN=TBCE PE=2 SV=1 2 498 7.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBD9|TBCE_PONAB Tubulin-specific chaperone E OS=Pongo abelii GN=TBCE PE=2 SV=1 7 498 3.0E-58
sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens GN=TBCE PE=1 SV=1 7 498 9.0E-58
sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 7 500 2.0E-57
sp|Q5FVQ9|TBCE_RAT Tubulin-specific chaperone E OS=Rattus norvegicus GN=Tbce PE=2 SV=1 7 500 3.0E-57
sp|Q32KS0|TBCE_BOVIN Tubulin-specific chaperone E OS=Bos taurus GN=TBCE PE=2 SV=1 2 498 7.0E-54
sp|Q5U378|TBCE_DANRE Tubulin-specific chaperone E OS=Danio rerio GN=tbce PE=2 SV=2 1 496 8.0E-52
sp|Q5U508|TBCE_XENLA Tubulin-specific chaperone E OS=Xenopus laevis GN=tbce PE=2 SV=1 9 502 3.0E-50
sp|Q8GRL7|TBCE_ARATH Tubulin-folding cofactor E OS=Arabidopsis thaliana GN=TFCE PE=2 SV=1 4 510 1.0E-39
sp|P39937|PAC2_YEAST Protein PAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC2 PE=1 SV=1 7 500 2.0E-28
sp|Q10303|ALP21_SCHPO Cell polarity protein alp21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp21 PE=1 SV=2 68 436 2.0E-19
sp|Q55CN0|TBCE_DICDI Tubulin-specific chaperone E OS=Dictyostelium discoideum GN=tbce PE=3 SV=1 6 351 2.0E-19
sp|Q5QJ74|TBCEL_HUMAN Tubulin-specific chaperone cofactor E-like protein OS=Homo sapiens GN=TBCEL PE=1 SV=2 79 445 3.0E-13
sp|Q5PQJ7|TBCEL_RAT Tubulin-specific chaperone cofactor E-like protein OS=Rattus norvegicus GN=Tbcel PE=1 SV=1 79 444 4.0E-13
sp|Q8C5W3|TBCEL_MOUSE Tubulin-specific chaperone cofactor E-like protein OS=Mus musculus GN=Tbcel PE=1 SV=1 79 444 1.0E-10
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 142 296 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6048
MTASPYVGQRISYGGALCTVRYVGPVAGTSGSWLGVEWDDGSRGRHKGSHKGVSYFTCLSSSPTAASFVRPSRPA
DTPRSFVAALKQRYAPDDDEQRDKTHGGPIVISGKVAEEMGFDKLRRRLARLRDLRIALLDGWCVASPPDDTQAS
VADTCPAIEHLDLSRNLLERLGSVLDICGQLPALRRLSLNGNRFHAVLDDPCLEDAPAAMSRVEELGLGETLLGW
EELGRIATACPSLTSLAVGTNQLCLLPTLDYGTLVSTLSTVNLEYNSFKALSDIASLASLGSLRNLDLKGNSISA
IAAPGAESPIFPPSLHYLDMSYNEIGDWAFVDGLGLHFPGLTGLRIAHNPVYGRSDTESGTPSLEESHMMTVARL
GRLKSVNFTQVRQGDRANAEMFYLSRIARQLAAVPEAAEHTVLARHPRYAELCEIYGAPDILRRDQVNPSFLEAR
LVTVAFYCGAKGPKTVRIPRSFDIYAVRGIAGKLFRLSPLKIRLVWETGEWDPVAGYDEAECGSDADDADDGHTG
HVGSRSPPCRLGESRHEGGIEEARDKSGRWVKREAELTDGPKQLGYCVDGHDVKIRLEVS*
Coding >OphauG2|6048
ATGACAGCCTCGCCCTACGTCGGGCAGCGCATCTCGTACGGCGGTGCTCTCTGCACGGTGCGCTACGTCGGCCCT
GTTGCCGGCACGAGTGGCTCGTGGCTCGGGGTCGAATGGGACGACGGGTCGCGTGGCCGGCACAAGGGCTCCCAC
AAGGGCGTCAGCTATTTCACGTGTCTCTCGTCATCGCCAACCGCCGCGTCGTTTGTGCGGCCCTCGCGTCCAGCC
GACACGCCACGAAGCTTCGTTGCCGCGCTCAAACAGAGATACGCCCCCGACGACGACGAGCAGCGCGACAAGACC
CATGGCGGACCCATTGTCATCTCGGGCAAGGTGGCAGAGGAAATGGGCTTCGACAAGCTGCGACGGCGCCTTGCA
CGGCTGCGTGACCTGCGCATTGCCTTGCTCGACGGCTGGTGCGTTGCGTCGCCGCCCGACGACACCCAGGCCTCA
GTGGCCGACACTTGTCCGGCCATTGAGCATCTGGATCTCAGCAGGAACCTTTTGGAGCGGCTTGGCTCGGTCCTC
GACATCTGTGGCCAATTGCCTGCCTTGCGTCGCCTGAGTCTCAATGGCAATCGCTTCCACGCTGTCCTCGACGAC
CCGTGCCTTGAAGATGCCCCAGCTGCCATGAGCCGTGTCGAGGAACTTGGCCTTGGCGAGACCTTGCTCGGCTGG
GAGGAGCTCGGCCGCATTGCCACGGCTTGTCCTAGTCTAACAAGCCTTGCTGTCGGCACCAACCAGCTCTGCTTG
CTGCCAACCCTCGACTATGGCACCCTCGTCTCAACACTGAGCACCGTCAATCTCGAGTATAACAGCTTCAAAGCC
TTGTCCGACATTGCCAGCCTCGCCAGCCTCGGGTCGCTGCGCAATCTTGACCTCAAGGGCAACAGCATTTCAGCC
ATTGCGGCTCCCGGTGCTGAGAGTCCCATATTCCCCCCGTCGTTGCATTATCTCGACATGTCGTACAATGAGATT
GGCGACTGGGCGTTTGTGGATGGCCTTGGCCTTCATTTCCCTGGCCTGACGGGCTTGCGCATCGCCCACAATCCC
GTCTACGGCCGCTCTGACACCGAGTCCGGGACTCCATCGCTCGAGGAATCTCACATGATGACAGTGGCCCGTCTG
GGCCGGCTCAAGAGCGTCAACTTCACACAGGTGCGACAAGGCGACCGCGCAAACGCCGAAATGTTTTATCTTTCT
CGAATTGCGCGCCAGCTCGCTGCTGTCCCCGAGGCGGCCGAACACACGGTCCTTGCCCGGCACCCACGCTATGCC
GAGCTGTGTGAAATATACGGCGCACCCGACATTCTTCGCCGCGACCAGGTCAACCCATCCTTTCTCGAGGCGCGG
CTCGTCACGGTCGCCTTTTACTGCGGCGCCAAGGGCCCCAAGACGGTGAGGATTCCAAGGTCGTTTGACATTTAT
GCCGTCCGAGGCATTGCGGGCAAGCTTTTCCGTCTCTCGCCCCTCAAGATACGTCTAGTCTGGGAAACTGGCGAG
TGGGATCCTGTCGCGGGCTATGACGAAGCCGAATGCGGGAGTGACGCCGACGACGCCGACGACGGCCACACTGGC
CATGTCGGCTCAAGAAGCCCACCATGTCGTCTTGGCGAGTCTCGCCACGAGGGAGGGATTGAGGAAGCAAGGGAC
AAATCTGGCCGCTGGGTCAAACGGGAAGCCGAATTGACAGATGGGCCAAAGCAACTAGGATACTGTGTCGACGGT
CATGATGTCAAGATCCGACTTGAAGTGTCGTGA
Transcript >OphauG2|6048
ATGACAGCCTCGCCCTACGTCGGGCAGCGCATCTCGTACGGCGGTGCTCTCTGCACGGTGCGCTACGTCGGCCCT
GTTGCCGGCACGAGTGGCTCGTGGCTCGGGGTCGAATGGGACGACGGGTCGCGTGGCCGGCACAAGGGCTCCCAC
AAGGGCGTCAGCTATTTCACGTGTCTCTCGTCATCGCCAACCGCCGCGTCGTTTGTGCGGCCCTCGCGTCCAGCC
GACACGCCACGAAGCTTCGTTGCCGCGCTCAAACAGAGATACGCCCCCGACGACGACGAGCAGCGCGACAAGACC
CATGGCGGACCCATTGTCATCTCGGGCAAGGTGGCAGAGGAAATGGGCTTCGACAAGCTGCGACGGCGCCTTGCA
CGGCTGCGTGACCTGCGCATTGCCTTGCTCGACGGCTGGTGCGTTGCGTCGCCGCCCGACGACACCCAGGCCTCA
GTGGCCGACACTTGTCCGGCCATTGAGCATCTGGATCTCAGCAGGAACCTTTTGGAGCGGCTTGGCTCGGTCCTC
GACATCTGTGGCCAATTGCCTGCCTTGCGTCGCCTGAGTCTCAATGGCAATCGCTTCCACGCTGTCCTCGACGAC
CCGTGCCTTGAAGATGCCCCAGCTGCCATGAGCCGTGTCGAGGAACTTGGCCTTGGCGAGACCTTGCTCGGCTGG
GAGGAGCTCGGCCGCATTGCCACGGCTTGTCCTAGTCTAACAAGCCTTGCTGTCGGCACCAACCAGCTCTGCTTG
CTGCCAACCCTCGACTATGGCACCCTCGTCTCAACACTGAGCACCGTCAATCTCGAGTATAACAGCTTCAAAGCC
TTGTCCGACATTGCCAGCCTCGCCAGCCTCGGGTCGCTGCGCAATCTTGACCTCAAGGGCAACAGCATTTCAGCC
ATTGCGGCTCCCGGTGCTGAGAGTCCCATATTCCCCCCGTCGTTGCATTATCTCGACATGTCGTACAATGAGATT
GGCGACTGGGCGTTTGTGGATGGCCTTGGCCTTCATTTCCCTGGCCTGACGGGCTTGCGCATCGCCCACAATCCC
GTCTACGGCCGCTCTGACACCGAGTCCGGGACTCCATCGCTCGAGGAATCTCACATGATGACAGTGGCCCGTCTG
GGCCGGCTCAAGAGCGTCAACTTCACACAGGTGCGACAAGGCGACCGCGCAAACGCCGAAATGTTTTATCTTTCT
CGAATTGCGCGCCAGCTCGCTGCTGTCCCCGAGGCGGCCGAACACACGGTCCTTGCCCGGCACCCACGCTATGCC
GAGCTGTGTGAAATATACGGCGCACCCGACATTCTTCGCCGCGACCAGGTCAACCCATCCTTTCTCGAGGCGCGG
CTCGTCACGGTCGCCTTTTACTGCGGCGCCAAGGGCCCCAAGACGGTGAGGATTCCAAGGTCGTTTGACATTTAT
GCCGTCCGAGGCATTGCGGGCAAGCTTTTCCGTCTCTCGCCCCTCAAGATACGTCTAGTCTGGGAAACTGGCGAG
TGGGATCCTGTCGCGGGCTATGACGAAGCCGAATGCGGGAGTGACGCCGACGACGCCGACGACGGCCACACTGGC
CATGTCGGCTCAAGAAGCCCACCATGTCGTCTTGGCGAGTCTCGCCACGAGGGAGGGATTGAGGAAGCAAGGGAC
AAATCTGGCCGCTGGGTCAAACGGGAAGCCGAATTGACAGATGGGCCAAAGCAACTAGGATACTGTGTCGACGGT
CATGATGTCAAGATCCGACTTGAAGTGTCGTGA
Gene >OphauG2|6048
ATGACAGCCTCGCCCTACGTCGGGCAGCGCATCTCGTACGGCGGTGCTCTCTGCACGGTGCGCTACGTCGGCCCT
GTTGCCGGCACGAGTGGCTCGTGGCTCGGGGTCGAATGGGACGACGGGTCGCGTGGCCGGCACAAGGGCTCCCAC
AAGGGCGTCAGCTATTTCACGTGTAGGATCATGGCCTTGCCTTGTTGTACCTCGCACTCATATAGGCTCCGACGC
TGCTAGGTCTCTCGTCATCGCCAACCGCCGCGTCGTTTGTGCGGCCCTCGCGTCCAGCCGACACGCCACGAAGCT
TCGTTGCCGCGCTCAAACAGAGATACGCCCCCGACGACGACGAGCAGCGCGACAAGACCCATGGCGGACCCATTG
TCATCTCGGGCAAGGTGGCAGAGGAAATGGGCTTCGACAAGCTGCGACGGCGCCTTGCACGGCTGCGTGACCTGC
GCATTGCCTTGCTCGACGGCTGGTGCGTTGCGTCGCCGCCCGACGACACCCAGGCCTCAGTGGCCGACACTTGTC
CGGCCATTGAGCATCTGGATCTCAGCAGGAACCTTTTGGAGCGGCTTGGCTCGGTCCTCGACATCTGTGGCCAAT
TGCCTGCCTTGCGTCGCCTGAGTCTCAAGTAAGAATGAGCCGTGGTTCCTGCGAATCTGTCTGGCTGATGGCAAC
ACCATGTCCGCAGTGGCAATCGCTTCCACGCTGTCCTCGACGACCCGTGCCTTGAAGATGCCCCAGCTGCCATGA
GCCGTGTCGAGGAACTTGGCCTTGGCGAGACCTTGCTCGGCTGGGAGGAGCTCGGCCGCATTGCCACGGCTTGTC
CTAGTCTAACAAGCCTTGCTGTCGGCACCAACCAGCTCTGCTTGCTGCCAACCCTCGACTATGGCACCCTCGTCT
CAACACTGAGCACCGTCAATCTCGAGTATAACAGCTTCAAAGCCTTGTCCGACATTGCCAGCCTCGCCAGCCTCG
GGTCGCTGCGCAATCTTGACCTCAAGGGCAACAGCATTTCAGCCATTGCGGCTCCCGGTGCTGAGAGTCCCATAT
TCCCCCCGTCGTTGCATTATCTCGACATGTCGTACAATGAGATTGGCGACTGGGCGTTTGTGGATGGCCTTGGCC
TTCATTTCCCTGGCCTGACGGGCTTGCGCATCGCCCACAATCCCGTCTACGGCCGCTCTGACACCGAGTCCGGGA
CTCCATCGCTCGAGGAATCTCACATGATGACAGTGGCCCGTCTGGGCCGGCTCAAGAGCGTCAACTTCACACAGG
TGCGACAAGGCGACCGCGCAAACGCCGAAATGTTTTATCTTTCTCGAATTGCGCGCCAGCTCGCTGCTGTCCCCG
AGGCGGCCGAACACACGGTCCTTGCCCGGCACCCACGCTATGCCGAGCTGTGTGAAATATACGGCGCACCCGACA
TTCTTCGCCGCGACCAGGTCAACCCATCCTTTCTCGAGGCGCGGCTCGTCACGGTCGCCTTTTACTGCGGCGCCA
AGGGCCCCAAGACGGTGAGGATTCCAAGGTCGTTTGACATTTATGCCGTCCGAGGCATTGCGGGCAAGCTTTTCC
GTCTCTCGCCCCTCAAGATACGTCTAGTCTGGGAAACTGGCGAGTGGGATCCTGTCGCGGGCTATGACGAAGCCG
AATGCGGGAGTGACGCCGACGACGCCGACGACGGCCACACTGGCCATGTCGGCTCAAGAAGCCCACCATGTCGTC
TTGGCGAGTCTCGCCACGAGGGAGGGATTGAGGAAGCAAGGGACAAATCTGGCCGCTGGGTCAAACGGGAAGCCG
AATTGACAGATGGGCCAAAGCAACTAGGATACTGTGTCGACGGTCATGATGTCAAGATCCGACTTGAAGTGTCGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail