Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6038
Gene name
LocationContig_593:10904..11746
Strand+
Gene length (bp)842
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02219 MTHFR Methylenetetrahydrofolate reductase 1.1E-60 29 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74927|MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met11 PE=1 SV=2 37 234 5.0E-50
sp|P46151|MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET12 PE=1 SV=2 34 249 9.0E-47
sp|Q10258|MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met9 PE=1 SV=1 23 249 9.0E-45
sp|O67422|METF_AQUAE 5,10-methylenetetrahydrofolate reductase OS=Aquifex aeolicus (strain VF5) GN=metF PE=3 SV=1 38 229 1.0E-38
sp|Q75HE6|MTHR_ORYSJ Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1 25 259 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74927|MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met11 PE=1 SV=2 37 234 5.0E-50
sp|P46151|MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET12 PE=1 SV=2 34 249 9.0E-47
sp|Q10258|MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met9 PE=1 SV=1 23 249 9.0E-45
sp|O67422|METF_AQUAE 5,10-methylenetetrahydrofolate reductase OS=Aquifex aeolicus (strain VF5) GN=metF PE=3 SV=1 38 229 1.0E-38
sp|Q75HE6|MTHR_ORYSJ Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1 25 259 3.0E-38
sp|P53128|MTHR2_YEAST Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET13 PE=1 SV=2 25 249 5.0E-38
sp|Q9SE60|MTHR1_ARATH Methylenetetrahydrofolate reductase 1 OS=Arabidopsis thaliana GN=MTHFR1 PE=1 SV=1 25 249 6.0E-37
sp|Q9SE94|MTHR1_MAIZE Methylenetetrahydrofolate reductase 1 OS=Zea mays PE=2 SV=1 25 259 1.0E-36
sp|O80585|MTHR2_ARATH Methylenetetrahydrofolate reductase 2 OS=Arabidopsis thaliana GN=MTHFR2 PE=1 SV=2 25 259 2.0E-36
sp|Q5I598|MTHR_BOVIN Methylenetetrahydrofolate reductase OS=Bos taurus GN=MTHFR PE=2 SV=1 24 249 3.0E-35
sp|Q9WU20|MTHR_MOUSE Methylenetetrahydrofolate reductase OS=Mus musculus GN=Mthfr PE=1 SV=2 24 249 1.0E-34
sp|P42898|MTHR_HUMAN Methylenetetrahydrofolate reductase OS=Homo sapiens GN=MTHFR PE=1 SV=3 24 249 3.0E-34
sp|Q60HE5|MTHR_MACFA Methylenetetrahydrofolate reductase OS=Macaca fascicularis GN=MTHFR PE=2 SV=1 24 249 1.0E-33
sp|O54235|METF_STRLI 5,10-methylenetetrahydrofolate reductase OS=Streptomyces lividans GN=metF PE=3 SV=1 16 249 2.0E-29
sp|Q17693|MTHR_CAEEL Probable methylenetetrahydrofolate reductase OS=Caenorhabditis elegans GN=mthf-1 PE=3 SV=2 28 240 4.0E-28
sp|P71319|METF_PECCC 5,10-methylenetetrahydrofolate reductase OS=Pectobacterium carotovorum subsp. carotovorum GN=metF PE=3 SV=1 38 251 6.0E-25
sp|Q8KA62|METF_BUCAP 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metF PE=3 SV=1 39 229 1.0E-21
sp|P11003|METF_SALTY 5,10-methylenetetrahydrofolate reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metF PE=3 SV=2 38 251 1.0E-20
sp|P45208|METF_HAEIN 5,10-methylenetetrahydrofolate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metF PE=3 SV=1 38 233 1.0E-19
sp|P0AEZ2|METF_SHIFL 5,10-methylenetetrahydrofolate reductase OS=Shigella flexneri GN=metF PE=3 SV=1 38 249 2.0E-19
sp|P0AEZ1|METF_ECOLI 5,10-methylenetetrahydrofolate reductase OS=Escherichia coli (strain K12) GN=metF PE=1 SV=1 38 249 2.0E-19
sp|P57154|METF_BUCAI 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metF PE=3 SV=1 19 230 7.0E-19
sp|Q9JZQ3|METF_NEIMB 5,10-methylenetetrahydrofolate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metF PE=1 SV=1 38 230 6.0E-18
sp|Q89B13|METF_BUCBP 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=metF PE=3 SV=1 38 244 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0004489 methylenetetrahydrofolate reductase (NAD(P)H) activity Yes
GO:0006555 methionine metabolic process Yes
GO:0009987 cellular process No
GO:0019752 carboxylic acid metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0008150 biological_process No
GO:0009066 aspartate family amino acid metabolic process No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0071704 organic substance metabolic process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0000096 sulfur amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6038
MRPLHLTASLLALSTTTASNTSADKITHKIASAAHDFVSLEFFPPKTPSGFTSLQSRVIRINEALQPLFVSVTWG
AGGSAAQDSLRLGGMLQRDLGITTLLHVTCRGMTRRRLDETLRRARELGIRNILALKGDVPRDDGDADEASGSGE
GSGEFIWAADLVRYIRRTHGGFFCIGVAGYPEGHFNASDAASRSVEHDVPYLVDKVSAGSDFIMTQIFFNASVFS
AYRERLSAHPVLRSIPVVPLFLAIPDACATGWCEGE*
Coding >OphauG2|6038
ATGAGACCCCTACACCTCACCGCCTCCCTCCTCGCCCTCAGCACCACCACCGCCTCCAACACCAGCGCCGATAAA
ATCACGCACAAAATAGCCTCGGCAGCACACGACTTTGTATCTCTGGAATTCTTCCCCCCCAAAACACCATCCGGC
TTTACCAGTCTCCAGTCTCGGGTCATCAGGATTAATGAGGCGCTACAGCCATTGTTTGTAAGCGTGACTTGGGGC
GCGGGCGGCTCTGCGGCTCAAGACTCGCTTCGGCTGGGGGGAATGTTGCAGCGGGATCTGGGAATCACGACTTTG
CTTCATGTTACGTGTCGCGGCATGACGAGGCGGCGGCTGGATGAGACGTTGAGGCGAGCTCGGGAGCTTGGGATT
CGGAATATTCTGGCGTTGAAGGGGGATGTGCCGCGAGATGACGGCGACGCGGATGAGGCGTCTGGTTCGGGGGAG
GGCTCAGGCGAGTTTATCTGGGCGGCAGACCTGGTGCGGTATATTCGCCGCACACACGGCGGCTTTTTCTGCATT
GGCGTGGCAGGATATCCTGAAGGGCACTTCAACGCCAGCGACGCCGCAAGCCGCAGCGTGGAGCACGATGTGCCG
TACCTGGTCGACAAGGTCTCTGCCGGCAGCGATTTCATCATGACGCAAATCTTCTTCAACGCCTCCGTCTTTTCT
GCCTATCGGGAAAGGCTGAGTGCTCATCCGGTGTTGAGGAGTATTCCTGTTGTTCCGCTTTTCCTCGCGATACCT
GATGCGTGCGCGACTGGATGGTGCGAGGGGGAGTGA
Transcript >OphauG2|6038
ATGAGACCCCTACACCTCACCGCCTCCCTCCTCGCCCTCAGCACCACCACCGCCTCCAACACCAGCGCCGATAAA
ATCACGCACAAAATAGCCTCGGCAGCACACGACTTTGTATCTCTGGAATTCTTCCCCCCCAAAACACCATCCGGC
TTTACCAGTCTCCAGTCTCGGGTCATCAGGATTAATGAGGCGCTACAGCCATTGTTTGTAAGCGTGACTTGGGGC
GCGGGCGGCTCTGCGGCTCAAGACTCGCTTCGGCTGGGGGGAATGTTGCAGCGGGATCTGGGAATCACGACTTTG
CTTCATGTTACGTGTCGCGGCATGACGAGGCGGCGGCTGGATGAGACGTTGAGGCGAGCTCGGGAGCTTGGGATT
CGGAATATTCTGGCGTTGAAGGGGGATGTGCCGCGAGATGACGGCGACGCGGATGAGGCGTCTGGTTCGGGGGAG
GGCTCAGGCGAGTTTATCTGGGCGGCAGACCTGGTGCGGTATATTCGCCGCACACACGGCGGCTTTTTCTGCATT
GGCGTGGCAGGATATCCTGAAGGGCACTTCAACGCCAGCGACGCCGCAAGCCGCAGCGTGGAGCACGATGTGCCG
TACCTGGTCGACAAGGTCTCTGCCGGCAGCGATTTCATCATGACGCAAATCTTCTTCAACGCCTCCGTCTTTTCT
GCCTATCGGGAAAGGCTGAGTGCTCATCCGGTGTTGAGGAGTATTCCTGTTGTTCCGCTTTTCCTCGCGATACCT
GATGCGTGCGCGACTGGATGGTGCGAGGGGGAGTGA
Gene >OphauG2|6038
ATGAGACCCCTACACCTCACCGCCTCCCTCCTCGCCCTCAGCACCACCACCGCCTCCAACACCAGCGCCGATAAA
ATCACGCACAAAATAGCCTCGGCAGCACACGACTTTGTATCTCTGGAATTCTTCCCCCCCAAAACACCATCCGGC
TTTACCAGTCTCCAGTCTCGGGTCATCAGGATTAATGAGGCGCTACAGCCATTGTTTGTAAGCGTGACTTGGGGC
GCGGGCGGCTCTGCGGCTCAAGACTCGCTTCGGCTGGGGGGAATGTTGCAGCGGGATCTGGGAATCACGACTTTG
CTTCATGTTACGTGTCGCGGCATGACGAGGCGGCGGCTGGATGAGACGTTGAGGCGAGCTCGGGAGCTTGGGATT
CGGAATATTCTGGCGTTGAAGGGGGATGTGCCGCGAGATGACGGCGACGCGGATGAGGCGTCTGGTTCGGGGGAG
GGCTCAGGCGAGTTTATCTGGGCGGCAGACCTGGTGCGGTATATTCGCCGCACACACGGCGGCTTTTTCTGCATT
GGCGTGGCAGGATATCCTGAAGGGCACTTCAACGCCAGCGACGCCGCAAGCCGCAGCGTGGAGCACGATGTGCCG
TACCTGGTCGACAAGGTCTCTGCCGGCAGCGATTTCATCATGACGCAAATCTTCTTCAACGCCTCCGTCTTTTCT
GCCTATCGGGAAAGGCTGAGTGCTCATCCGGTGTTGAGGAGTATTCCTGTTGTTCCGCTTTTCCTCGCGATACCT
GGTGCGAGAGGCTTGGATCGAGTGCTTGGGCTGGCTCATGCGACGATGCCGGATGAGATGCGTGCGCGACTGGAT
GGTGCGAGGGGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail