Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6030
Gene name
LocationContig_592:2796..3671
Strand+
Gene length (bp)875
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 2.5E-10 121 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZW86|P4H1_ARATH Prolyl 4-hydroxylase 1 OS=Arabidopsis thaliana GN=P4H1 PE=1 SV=1 36 244 2.0E-20
sp|F4JAU3|P4H2_ARATH Prolyl 4-hydroxylase 2 OS=Arabidopsis thaliana GN=P4H2 PE=1 SV=1 1 241 3.0E-20
sp|Q8LAN3|P4H4_ARATH Probable prolyl 4-hydroxylase 4 OS=Arabidopsis thaliana GN=P4H4 PE=2 SV=1 34 241 2.0E-19
sp|Q24JN5|P4H5_ARATH Prolyl 4-hydroxylase 5 OS=Arabidopsis thaliana GN=P4H5 PE=2 SV=1 5 241 1.0E-15
sp|Q8L970|P4H7_ARATH Probable prolyl 4-hydroxylase 7 OS=Arabidopsis thaliana GN=P4H7 PE=2 SV=1 34 241 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZW86|P4H1_ARATH Prolyl 4-hydroxylase 1 OS=Arabidopsis thaliana GN=P4H1 PE=1 SV=1 36 244 2.0E-20
sp|F4JAU3|P4H2_ARATH Prolyl 4-hydroxylase 2 OS=Arabidopsis thaliana GN=P4H2 PE=1 SV=1 1 241 3.0E-20
sp|Q8LAN3|P4H4_ARATH Probable prolyl 4-hydroxylase 4 OS=Arabidopsis thaliana GN=P4H4 PE=2 SV=1 34 241 2.0E-19
sp|Q24JN5|P4H5_ARATH Prolyl 4-hydroxylase 5 OS=Arabidopsis thaliana GN=P4H5 PE=2 SV=1 5 241 1.0E-15
sp|Q8L970|P4H7_ARATH Probable prolyl 4-hydroxylase 7 OS=Arabidopsis thaliana GN=P4H7 PE=2 SV=1 34 241 2.0E-14
sp|F4J0A8|P4H6_ARATH Probable prolyl 4-hydroxylase 6 OS=Arabidopsis thaliana GN=P4H6 PE=2 SV=1 38 241 2.0E-14
sp|F4JNU8|P4H8_ARATH Probable prolyl 4-hydroxylase 8 OS=Arabidopsis thaliana GN=P4H8 PE=3 SV=1 35 241 3.0E-14
sp|Q6W3E9|P4HA3_RAT Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus norvegicus GN=P4ha3 PE=2 SV=1 42 244 2.0E-13
sp|Q9LN20|P4H3_ARATH Probable prolyl 4-hydroxylase 3 OS=Arabidopsis thaliana GN=P4H3 PE=2 SV=1 37 241 2.0E-12
sp|F4JZ24|P4H10_ARATH Probable prolyl 4-hydroxylase 10 OS=Arabidopsis thaliana GN=P4H10 PE=2 SV=1 35 243 2.0E-12
sp|Q5ZLK5|P4HA2_CHICK Prolyl 4-hydroxylase subunit alpha-2 OS=Gallus gallus GN=P4HA2 PE=2 SV=1 41 244 7.0E-12
sp|Q6W3F0|P4HA3_MOUSE Prolyl 4-hydroxylase subunit alpha-3 OS=Mus musculus GN=P4ha3 PE=2 SV=1 35 244 2.0E-11
sp|Q5UP57|P4H_MIMIV Putative prolyl 4-hydroxylase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L593 PE=1 SV=1 40 244 7.0E-11
sp|Q7Z4N8|P4HA3_HUMAN Prolyl 4-hydroxylase subunit alpha-3 OS=Homo sapiens GN=P4HA3 PE=1 SV=1 35 244 7.0E-11
sp|Q60716|P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus GN=P4ha2 PE=1 SV=1 41 244 1.0E-10
sp|F4ILF8|P4H13_ARATH Prolyl 4-hydroxylase 13 OS=Arabidopsis thaliana GN=P4H13 PE=2 SV=1 25 244 8.0E-10
sp|O15460|P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens GN=P4HA2 PE=1 SV=1 41 244 2.0E-09
sp|Q75UG4|P4HA3_BOVIN Prolyl 4-hydroxylase subunit alpha-3 OS=Bos taurus GN=P4HA3 PE=2 SV=1 35 244 2.0E-09
sp|P54001|P4HA1_RAT Prolyl 4-hydroxylase subunit alpha-1 OS=Rattus norvegicus GN=P4ha1 PE=2 SV=2 76 244 9.0E-09
sp|P16924|P4HA1_CHICK Prolyl 4-hydroxylase subunit alpha-1 OS=Gallus gallus GN=P4HA1 PE=1 SV=1 27 244 1.0E-08
sp|Q1RMU3|P4HA1_BOVIN Prolyl 4-hydroxylase subunit alpha-1 OS=Bos taurus GN=P4HA1 PE=1 SV=1 76 244 1.0E-08
sp|Q60715|P4HA1_MOUSE Prolyl 4-hydroxylase subunit alpha-1 OS=Mus musculus GN=P4ha1 PE=1 SV=2 66 244 2.0E-08
sp|Q5RAG8|P4HA1_PONAB Prolyl 4-hydroxylase subunit alpha-1 OS=Pongo abelii GN=P4HA1 PE=2 SV=1 76 244 4.0E-08
sp|P13674|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2 76 244 4.0E-08
sp|Q10576|P4HA1_CAEEL Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabditis elegans GN=dpy-18 PE=1 SV=2 34 244 3.0E-07
sp|Q8VZJ7|P4H9_ARATH Probable prolyl 4-hydroxylase 9 OS=Arabidopsis thaliana GN=P4H9 PE=2 SV=1 36 244 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6030
MARLLVNIAALSLTLRIATAGLQDDSGCRHPGYQVHLVSSSPLVMYLEGFLTADERAHLEHVGQGRFTDSAVLAA
SGEAAIHNVRTSQSTAIQRDAVVECIEQRALSIQGFDRLASQLEPMQLVRYGPRQRYHFHTDWFTDPTHAAAQRG
GNRASSIFGYVKAHNVTGGGTNFPLLNVPRNERWCRFVDCDAEYESGLTFRPVEGNAIYWDNMLEPGRGDERTLH
AGLPVVTGDKIGINIWTREAPLPVELRGQGAAAGTSL*
Coding >OphauG2|6030
ATGGCTCGTCTACTAGTGAATATTGCGGCGCTCAGCCTCACTCTCAGGATTGCAACAGCAGGCTTGCAAGACGAC
AGCGGCTGCAGGCACCCTGGATACCAGGTGCATCTCGTCAGCTCGTCGCCGCTCGTCATGTACCTCGAGGGCTTT
CTCACTGCCGACGAGAGAGCGCACCTCGAGCACGTAGGCCAAGGACGCTTCACCGACTCGGCGGTGCTGGCGGCA
TCGGGCGAGGCAGCAATCCACAATGTGCGCACGTCGCAGTCAACGGCGATCCAGCGCGACGCAGTTGTAGAGTGC
ATTGAGCAGAGAGCCCTGTCCATTCAAGGCTTTGATAGATTGGCGTCGCAGCTGGAGCCAATGCAGCTGGTGCGA
TACGGCCCGCGCCAGCGCTACCACTTCCACACCGACTGGTTCACGGACCCGACACACGCAGCGGCACAGCGCGGG
GGCAATCGGGCCAGCTCAATCTTTGGCTATGTCAAGGCGCACAATGTGACGGGAGGCGGCACAAACTTTCCGCTG
CTCAATGTGCCGCGCAACGAGCGCTGGTGTCGCTTCGTCGACTGCGACGCCGAGTACGAGAGCGGCCTGACATTC
CGGCCTGTCGAGGGCAACGCCATCTACTGGGACAATATGCTGGAGCCGGGCCGTGGCGACGAGCGCACGCTGCAC
GCCGGGCTGCCCGTCGTCACCGGCGACAAGATTGGCATCAACATCTGGACGCGAGAGGCGCCGCTGCCAGTTGAG
TTGCGAGGACAAGGAGCGGCGGCGGGCACGTCTTTGTAG
Transcript >OphauG2|6030
ATGGCTCGTCTACTAGTGAATATTGCGGCGCTCAGCCTCACTCTCAGGATTGCAACAGCAGGCTTGCAAGACGAC
AGCGGCTGCAGGCACCCTGGATACCAGGTGCATCTCGTCAGCTCGTCGCCGCTCGTCATGTACCTCGAGGGCTTT
CTCACTGCCGACGAGAGAGCGCACCTCGAGCACGTAGGCCAAGGACGCTTCACCGACTCGGCGGTGCTGGCGGCA
TCGGGCGAGGCAGCAATCCACAATGTGCGCACGTCGCAGTCAACGGCGATCCAGCGCGACGCAGTTGTAGAGTGC
ATTGAGCAGAGAGCCCTGTCCATTCAAGGCTTTGATAGATTGGCGTCGCAGCTGGAGCCAATGCAGCTGGTGCGA
TACGGCCCGCGCCAGCGCTACCACTTCCACACCGACTGGTTCACGGACCCGACACACGCAGCGGCACAGCGCGGG
GGCAATCGGGCCAGCTCAATCTTTGGCTATGTCAAGGCGCACAATGTGACGGGAGGCGGCACAAACTTTCCGCTG
CTCAATGTGCCGCGCAACGAGCGCTGGTGTCGCTTCGTCGACTGCGACGCCGAGTACGAGAGCGGCCTGACATTC
CGGCCTGTCGAGGGCAACGCCATCTACTGGGACAATATGCTGGAGCCGGGCCGTGGCGACGAGCGCACGCTGCAC
GCCGGGCTGCCCGTCGTCACCGGCGACAAGATTGGCATCAACATCTGGACGCGAGAGGCGCCGCTGCCAGTTGAG
TTGCGAGGACAAGGAGCGGCGGCGGGCACGTCTTTGTAG
Gene >OphauG2|6030
ATGGCTCGTCTACTAGTGAATATTGCGGCGCTCAGCCTCACTCTCAGGATTGCAACAGCAGGCTTGCAAGACGAC
AGCGGCTGCAGGCACCCTGGATACCAGGTGCATCTCGTCAGCTCGTCGCCGCTCGTCATGTACCTCGAGGGCTTT
CTCACTGCCGACGAGAGAGCGCACCTCGAGCACGTAGGGTAGGCAGCTTCCCAGGCAGCTCCTTGTGCAGCTTCT
TCCAAGGCACGGCTGGGGCAAAGAGTCAAGACTGACAGACTGGTGACAGCCAAGGACGCTTCACCGACTCGGCGG
TGCTGGCGGCATCGGGCGAGGCAGCAATCCACAATGTGCGCACGTCGCAGTCAACGGCGATCCAGCGCGACGCAG
TTGTAGAGTGCATTGAGCAGAGAGCCCTGTCCATTCAAGGCTTTGATAGATTGGCGTCGCAGCTGGAGCCAATGC
AGCTGGTGCGATACGGCCCGCGCCAGCGCTACCACTTCCACACCGACTGGTTCACGGACCCGACACACGCAGCGG
CACAGCGCGGGGGCAATCGGGCCAGCTCAATCTTTGGCTATGTCAAGGCGCACAATGTGACGGGAGGCGGCACAA
ACTTTCCGCTGCTCAATGTGCCGCGCAACGAGCGCTGGTGTCGCTTCGTCGACTGCGACGCCGAGTACGAGAGCG
GCCTGACATTCCGGCCTGTCGAGGGCAACGCCATCTACTGGGACAATATGCTGGAGCCGGGCCGTGGCGACGAGC
GCACGCTGCACGCCGGGCTGCCCGTCGTCACCGGCGACAAGATTGGCATCAACATCTGGACGCGAGAGGCGCCGC
TGCCAGTTGAGTTGCGAGGACAAGGAGCGGCGGCGGGCACGTCTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail