Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6029
Gene name
LocationContig_592:1083..2450
Strand-
Gene length (bp)1367
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 5.0E-09 31 121
PF13848 Thioredoxin_6 Thioredoxin-like domain 4.7E-07 157 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 37 335 2.0E-22
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 1 335 1.0E-21
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 32 335 2.0E-21
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 15 335 9.0E-21
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 40 335 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 37 335 2.0E-22
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 1 335 1.0E-21
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 32 335 2.0E-21
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 15 335 9.0E-21
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 40 335 3.0E-18
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 32 317 1.0E-16
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 29 336 2.0E-14
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 37 331 7.0E-12
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 43 182 1.0E-10
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 33 279 4.0E-10
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 126 335 6.0E-09
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 44 176 8.0E-09
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 44 176 2.0E-08
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 37 333 3.0E-08
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 44 176 4.0E-08
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 44 176 5.0E-08
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 44 176 5.0E-08
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 44 176 6.0E-08
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 44 335 8.0E-08
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 44 176 1.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 29 176 1.0E-07
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 29 177 2.0E-07
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 29 177 3.0E-07
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 44 335 4.0E-07
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 44 335 7.0E-07
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 33 174 7.0E-07
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 29 181 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6029
MKSLLMPRAALGLALLAAAGHATTWKHSDAAALRQQMAQNEHTLVAFVASETQSTKALLPEWNAVDDGEVPLSSV
NCSTADALCAQLDVVSFPAIRLYRRNKPMVRYRGPRKALSIVSFLQRIKRPVVSHLSNNDGLDDFLASDGVVVVA
HLGSHDGSLLARFSSLADTYHDRYSFGLVSHEPGAANFVQCRNNMDAMEHEQSQVDRAGDFERFLSKCAEPLVPE
LSRRTELQYAKTGKSLVYYLSDDETWREAQARIMNPLAKQYGDYLQFVTVDSAEYPELPRNLGLAARQGLVVENR
HTGDKFPYPSAAASALDVNAVAQFIDAIAQGSVMPWKGHEQYQHDEL*
Coding >OphauG2|6029
ATGAAGTCATTGTTGATGCCACGTGCCGCCCTCGGCCTTGCTCTTCTTGCAGCTGCTGGGCACGCGACAACATGG
AAACACAGTGATGCTGCCGCCCTCAGACAGCAAATGGCCCAAAACGAGCACACGCTCGTTGCATTTGTCGCGTCG
GAAACACAATCGACCAAAGCTCTACTGCCTGAGTGGAATGCCGTCGACGACGGCGAGGTGCCCTTGTCATCCGTC
AATTGCTCAACGGCAGACGCTCTCTGCGCCCAACTCGACGTGGTGTCATTTCCTGCCATTCGACTCTATCGTCGC
AACAAGCCCATGGTTCGATATCGGGGACCGCGCAAGGCCTTGTCCATCGTCTCGTTTCTTCAGCGCATCAAACGT
CCCGTCGTCAGCCACCTGAGCAATAACGACGGCCTTGACGACTTCCTGGCCAGCGATGGGGTTGTGGTGGTGGCC
CATCTCGGTAGCCATGACGGCTCGCTGCTGGCGCGCTTCTCGTCTCTGGCAGACACGTACCATGACCGATATAGC
TTCGGCCTCGTGTCGCACGAGCCAGGGGCAGCAAATTTTGTCCAGTGCCGCAACAACATGGATGCCATGGAGCAT
GAGCAGAGCCAAGTGGATCGGGCGGGGGATTTTGAGAGGTTTCTCTCAAAGTGCGCCGAGCCGCTGGTTCCCGAG
TTGAGCCGCAGGACAGAGTTGCAATACGCAAAGACAGGCAAGAGCCTCGTGTATTATCTGAGCGACGACGAGACA
TGGCGCGAGGCTCAAGCGCGCATCATGAATCCATTGGCCAAGCAGTATGGCGATTATCTGCAGTTTGTTACTGTC
GACTCGGCTGAATATCCCGAGCTGCCACGCAACTTGGGGCTGGCCGCGCGACAAGGTCTTGTCGTCGAGAACCGA
CACACGGGCGACAAGTTTCCCTATCCGTCAGCAGCAGCTTCAGCGCTCGACGTGAATGCAGTGGCGCAATTCATT
GATGCCATTGCTCAAGGCAGCGTCATGCCTTGGAAGGGCCACGAGCAATACCAACACGACGAGTTGTAA
Transcript >OphauG2|6029
ATGAAGTCATTGTTGATGCCACGTGCCGCCCTCGGCCTTGCTCTTCTTGCAGCTGCTGGGCACGCGACAACATGG
AAACACAGTGATGCTGCCGCCCTCAGACAGCAAATGGCCCAAAACGAGCACACGCTCGTTGCATTTGTCGCGTCG
GAAACACAATCGACCAAAGCTCTACTGCCTGAGTGGAATGCCGTCGACGACGGCGAGGTGCCCTTGTCATCCGTC
AATTGCTCAACGGCAGACGCTCTCTGCGCCCAACTCGACGTGGTGTCATTTCCTGCCATTCGACTCTATCGTCGC
AACAAGCCCATGGTTCGATATCGGGGACCGCGCAAGGCCTTGTCCATCGTCTCGTTTCTTCAGCGCATCAAACGT
CCCGTCGTCAGCCACCTGAGCAATAACGACGGCCTTGACGACTTCCTGGCCAGCGATGGGGTTGTGGTGGTGGCC
CATCTCGGTAGCCATGACGGCTCGCTGCTGGCGCGCTTCTCGTCTCTGGCAGACACGTACCATGACCGATATAGC
TTCGGCCTCGTGTCGCACGAGCCAGGGGCAGCAAATTTTGTCCAGTGCCGCAACAACATGGATGCCATGGAGCAT
GAGCAGAGCCAAGTGGATCGGGCGGGGGATTTTGAGAGGTTTCTCTCAAAGTGCGCCGAGCCGCTGGTTCCCGAG
TTGAGCCGCAGGACAGAGTTGCAATACGCAAAGACAGGCAAGAGCCTCGTGTATTATCTGAGCGACGACGAGACA
TGGCGCGAGGCTCAAGCGCGCATCATGAATCCATTGGCCAAGCAGTATGGCGATTATCTGCAGTTTGTTACTGTC
GACTCGGCTGAATATCCCGAGCTGCCACGCAACTTGGGGCTGGCCGCGCGACAAGGTCTTGTCGTCGAGAACCGA
CACACGGGCGACAAGTTTCCCTATCCGTCAGCAGCAGCTTCAGCGCTCGACGTGAATGCAGTGGCGCAATTCATT
GATGCCATTGCTCAAGGCAGCGTCATGCCTTGGAAGGGCCACGAGCAATACCAACACGACGAGTTGTAA
Gene >OphauG2|6029
ATGAAGTCATTGTTGATGCCACGTGCCGCCCTCGGCCTTGCTCTTCTTGCAGCTGCTGGGCACGCGACAACATGG
AAACACAGTGATGCTGCCGCCCTCAGACAGCAAATGGCCCAAAACGAGCACACGCTCGTTGCATGTAAGTGGTCT
CGTTTGTGAGACTGCGCAACGCGTCTGGCGGCTGACACTGCTTTTTCTCCTCCACAGTTGTCGCGGTAGGTTGAG
ACGAGGCCGTCAAGCCGTCCCTTTCTGCCACGAGGCGCTGACCACGATACTGATTGGCCTAGTCGGAAACGTGAG
ATGCATGCGAGACCCCCCAAGACAAAGAGGCCAAAGGGCTGACACATGTGCAGACAATCGACCAAAGCTCTACTG
CCTGAGTGGAATGCCGTCGACGACGGCGAGGTGCCCTTGTCATCCGTCAATTGCTCAACGGCAGACGCTCTCTGC
GCCCAACTCGACGTGGTGTCATTTCCTGCCATTCGACTCTATCGTCGCAACAAGCCCATGGTTCGATATCGGGGA
CCGCGCAAGGCCTTGTCGTACGTCGGTCCGTCTCATGATGAAATGGGCGTGGTATGCGTCATCTGACTGGTAAAC
AGCATCGTCTCGTTTCTTCAGCGCATCAAACGTCCCGTCGTCAGCCACCTGAGCAATAACGACGGCCTTGACGAC
TTCCTGGCCAGCGATGGGGTTGTGGTGGTGGCCCATCTCGGTAGCCATGACGGCTCGCTGCTGGCGCGCTTCTCG
TCTCTGGCAGACACGTACCATGACCGATATAGCTTCGGCCTCGTGTCGCACGAGCCAGGGGCAGCAAATTTTGTC
CAGTGCCGCAACAACATGGATGCCATGGAGCATGAGCAGAGCCAAGTGGATCGGGCGGGGGATTTTGAGAGGTTT
CTCTCAAAGTGCGCCGAGCCGCTGGTTCCCGAGTTGAGCCGCAGGACAGAGTTGCAATACGCAAAGGTGGGAAGA
CAGTGTCGACGACGCCTTGGCCCTGGTGCCTGCTAACAATTGCGGCCATGTACCAGACAGGCAAGAGCCTCGTGT
ATTATCTGAGCGACGACGAGACATGGCGCGAGGCTCAAGCGCGCATCATGAATCCATTGGCCAAGCAGTATGGCG
ATTATCTGCAGTTTGTTACTGTCGACTCGGCTGAATATCCCGAGCTGCCACGCAACTTGGGGCTGGCCGCGCGAC
AAGGTCTTGTCGTCGAGAACCGACACACGGGCGACAAGTTTCCCTATCCGTCAGCAGCAGCTTCAGCGCTCGACG
TGAATGCAGTGGCGCAATTCATTGATGCCATTGCTCAAGGCAGCGTCATGCCTTGGAAGGGCCACGAGCAATACC
AACACGACGAGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail