Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6026
Gene name
LocationContig_591:5065..7832
Strand+
Gene length (bp)2767
Transcript length (bp)2652
Coding sequence length (bp)2652
Protein length (aa) 884

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 1.1E-16 15 96
PF01822 WSC WSC domain 2.6E-17 158 238
PF01822 WSC WSC domain 2.2E-16 267 350
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 2.1E-25 429 628
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 1.2E-20 766 862

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 11 881 0.0E+00
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 2 246 7.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 149 357 5.0E-20
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 14 244 3.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 158 359 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 11 881 0.0E+00
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 2 246 7.0E-22
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 149 357 5.0E-20
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 14 244 3.0E-18
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 158 359 3.0E-17
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 14 103 3.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 14 103 8.0E-14
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 14 109 3.0E-13
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 263 357 6.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 151 357 9.0E-12
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 249 357 3.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 15 172 1.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 159 318 1.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 15 104 3.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 15 208 3.0E-10
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 269 357 8.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 159 357 1.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 16 104 1.0E-09
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1 103 1.0E-09
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 266 357 1.0E-09
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 266 357 2.0E-09
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 159 357 7.0E-09
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 260 407 2.0E-08
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 266 357 2.0E-08
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 15 103 3.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 16 104 4.0E-08
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 267 357 5.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 267 357 6.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 269 357 1.0E-07
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 159 283 1.0E-07
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 159 247 4.0E-07
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 159 245 6.0E-07
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 159 245 8.0E-07
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 159 245 1.0E-06
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 159 318 2.0E-06
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 159 318 2.0E-06
sp|P0CS93|GAOA_GIBZA Galactose oxidase OS=Gibberella zeae GN=GAOA PE=1 SV=1 647 862 4.0E-06
sp|I1S2N3|GAOA_GIBZE Galactose oxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GAOA PE=3 SV=1 647 862 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6026
MPVPVENPGLDGWKFMGCHSEGAEGRALGHGVNTVAGDNMTVARCLSACGTDGYVLAGVEYGGECYCGQGLSKGA
APADSGCDIRCRGNSSEYCGGARRLSLYSHSAASGLLDIVERAMPADSTSTSTNTSISATSASLAATNTATDVPG
LPSGWASYGCWVDGVNGRILSQQLADDSNLTVQSCASKCAGLGFSVAGAEYHNQCFCGKQIINGGVRAKSAAECD
TPCSGDSKQMCGGGGRMTILSLGEPAVFEPPRVVPSVGNWTYYGCVEDNIGQKRTFFWQSFSDALTPASCLHRCA
EYGYMAAGLEYGRECYCGDAANMDTAGAHVVDDSQCNIACAGNASALCGGGSRLTTYLWRGPTPLYSWTFAAPAT
PQAGSYDFLIGGVCIPLMTSQTITGKVTFLEKWGTGPPNSTGAYELDLSLVANASAAWREMHVKTDIFCAAGATL
PDRAGRQLTVGGWSGDSTYGVRLYTPDAAGRNDWQENVDVLRLKNGRWYPSTMVMANGSILVIGGEQGSNGAPVP
TLELLPPPPASRALYMDWLERTDPNNLYPFVCVLPSGGILAVYWNEARILSDVDFSTIRLLPPVPGAVNDARAGR
TYPLEGAAVLLPQRAPYTEPLGVLICGGSNEGPANALDNCVSIYPDAPNARWAIERMPSPRVMPCIAPLPDGTYL
VLNGATHGVAGFGLGSGPNLNALLYNPAKPLGSRFTVMANTSVARMYHSEAITLLDGRVLVSGSDPQDGINPQEY
RVETFTPPYLLAGKRRPTFSLANQTDWQYGQQVRFTLGSLPVNGPISVSLLGSVSSTHGNSMGARTIFPAVSCSG
TSCSVTAPPGKYICPPGWYQFFLLDGGIPAVGVFVRIGGDPAGLGKWPKGPGFTTPDL*
Coding >OphauG2|6026
ATGCCTGTCCCTGTAGAGAACCCAGGGTTGGATGGCTGGAAGTTTATGGGATGCCATTCCGAGGGAGCCGAGGGA
CGCGCTCTGGGGCACGGCGTCAACACCGTCGCTGGAGACAACATGACAGTGGCCAGATGTCTGTCAGCATGCGGC
ACGGATGGATATGTACTGGCAGGCGTCGAGTATGGAGGCGAGTGCTATTGCGGCCAAGGCCTGTCCAAGGGAGCA
GCGCCAGCCGACAGCGGCTGCGATATCAGGTGCAGGGGCAACAGCTCCGAGTACTGCGGAGGGGCCAGACGATTG
TCTCTCTACTCGCACTCGGCCGCATCAGGCCTGTTGGATATTGTGGAGCGGGCAATGCCAGCCGACAGCACCAGC
ACCAGCACCAACACCAGCATCAGCGCCACCTCGGCCAGCCTAGCAGCGACCAACACAGCCACAGACGTGCCGGGC
TTGCCCTCGGGATGGGCATCGTACGGCTGCTGGGTCGATGGCGTCAACGGCCGTATCCTCAGCCAGCAGCTGGCC
GACGACAGCAATCTGACAGTGCAGTCGTGCGCCTCCAAGTGTGCTGGGCTCGGCTTCAGCGTGGCCGGAGCCGAA
TACCACAACCAGTGCTTCTGTGGCAAGCAAATCATCAATGGCGGCGTCCGCGCAAAGTCGGCGGCCGAGTGCGAC
ACGCCGTGCAGCGGCGACAGCAAGCAGATGTGCGGAGGCGGCGGGCGAATGACCATTTTGTCGCTGGGCGAGCCG
GCCGTGTTTGAGCCGCCGCGAGTGGTGCCCAGCGTGGGCAACTGGACCTACTATGGCTGCGTCGAGGACAACATT
GGGCAGAAGCGCACCTTTTTCTGGCAGAGCTTCTCCGACGCCCTGACGCCCGCCTCGTGTCTGCATCGCTGCGCC
GAGTACGGCTACATGGCCGCCGGCCTCGAGTACGGGCGCGAGTGCTACTGCGGCGACGCTGCAAACATGGACACG
GCCGGGGCGCACGTGGTGGACGACAGCCAGTGCAACATTGCCTGCGCCGGCAACGCCTCGGCCCTGTGCGGCGGC
GGCAGCCGGCTGACCACGTACCTCTGGCGCGGCCCGACGCCCCTCTACTCTTGGACCTTTGCCGCGCCGGCAACG
CCCCAGGCCGGCTCGTACGACTTCCTCATTGGCGGCGTGTGCATCCCGCTCATGACGTCCCAGACCATCACCGGC
AAGGTCACCTTTCTCGAGAAATGGGGCACCGGCCCCCCAAACTCCACGGGCGCCTACGAGCTCGACCTGTCCCTC
GTCGCCAACGCCTCGGCCGCCTGGCGCGAGATGCACGTCAAGACGGACATCTTCTGTGCCGCCGGCGCCACCCTG
CCCGACCGCGCCGGCCGCCAGCTGACCGTGGGCGGATGGTCGGGCGACTCGACGTACGGAGTGCGCCTCTACACC
CCCGACGCCGCCGGCCGCAACGACTGGCAGGAGAATGTCGACGTGCTGCGCCTCAAGAACGGCCGCTGGTACCCG
TCCACCATGGTCATGGCCAACGGCTCCATCCTCGTCATTGGCGGCGAGCAAGGCTCCAACGGCGCTCCCGTGCCC
ACTCTGGAGCTGCTGCCGCCCCCTCCCGCCTCGCGCGCCCTCTACATGGACTGGCTGGAGCGCACCGACCCCAAC
AACCTCTATCCCTTTGTCTGCGTCCTGCCCTCGGGCGGCATCCTGGCCGTTTACTGGAACGAGGCCCGCATCCTC
AGCGACGTCGACTTCTCCACCATTCGCCTGCTGCCGCCCGTGCCCGGTGCCGTCAACGATGCCCGCGCCGGACGC
ACCTATCCCCTGGAAGGCGCTGCAGTCCTGCTCCCCCAACGCGCTCCCTACACCGAGCCTCTGGGCGTTTTGATT
TGCGGAGGCTCCAACGAGGGTCCCGCCAATGCCCTCGACAACTGCGTCTCCATCTACCCCGATGCCCCCAATGCC
CGCTGGGCCATTGAGCGCATGCCTTCGCCTCGCGTCATGCCCTGCATTGCGCCCCTGCCAGACGGCACCTACCTG
GTCCTCAACGGAGCCACTCATGGCGTTGCCGGCTTCGGCCTTGGCTCCGGCCCAAACCTCAACGCCCTGCTTTAC
AACCCCGCCAAGCCCCTGGGCAGTCGCTTCACCGTCATGGCCAACACATCCGTCGCTCGCATGTATCACTCAGAG
GCCATCACCCTGCTCGATGGCCGTGTTCTCGTCTCGGGCTCGGATCCTCAAGATGGCATCAATCCCCAAGAGTAT
CGCGTCGAGACCTTTACACCCCCATACCTCCTTGCCGGCAAGCGCCGACCAACCTTTAGCCTGGCCAACCAGACC
GACTGGCAATACGGCCAGCAGGTGCGCTTTACCCTGGGCAGCCTGCCTGTCAACGGCCCCATTTCAGTATCCCTG
CTTGGATCCGTCTCCAGCACCCATGGTAATTCCATGGGAGCTCGCACCATATTTCCCGCAGTCTCGTGTTCTGGT
ACCTCTTGCAGCGTTACTGCCCCGCCTGGAAAGTATATTTGCCCTCCTGGCTGGTACCAGTTCTTCCTTCTCGAC
GGGGGTATCCCCGCCGTCGGTGTTTTTGTCCGAATCGGAGGAGATCCGGCCGGCCTGGGAAAATGGCCCAAGGGC
CCTGGCTTCACAACTCCCGATTTGTAA
Transcript >OphauG2|6026
ATGCCTGTCCCTGTAGAGAACCCAGGGTTGGATGGCTGGAAGTTTATGGGATGCCATTCCGAGGGAGCCGAGGGA
CGCGCTCTGGGGCACGGCGTCAACACCGTCGCTGGAGACAACATGACAGTGGCCAGATGTCTGTCAGCATGCGGC
ACGGATGGATATGTACTGGCAGGCGTCGAGTATGGAGGCGAGTGCTATTGCGGCCAAGGCCTGTCCAAGGGAGCA
GCGCCAGCCGACAGCGGCTGCGATATCAGGTGCAGGGGCAACAGCTCCGAGTACTGCGGAGGGGCCAGACGATTG
TCTCTCTACTCGCACTCGGCCGCATCAGGCCTGTTGGATATTGTGGAGCGGGCAATGCCAGCCGACAGCACCAGC
ACCAGCACCAACACCAGCATCAGCGCCACCTCGGCCAGCCTAGCAGCGACCAACACAGCCACAGACGTGCCGGGC
TTGCCCTCGGGATGGGCATCGTACGGCTGCTGGGTCGATGGCGTCAACGGCCGTATCCTCAGCCAGCAGCTGGCC
GACGACAGCAATCTGACAGTGCAGTCGTGCGCCTCCAAGTGTGCTGGGCTCGGCTTCAGCGTGGCCGGAGCCGAA
TACCACAACCAGTGCTTCTGTGGCAAGCAAATCATCAATGGCGGCGTCCGCGCAAAGTCGGCGGCCGAGTGCGAC
ACGCCGTGCAGCGGCGACAGCAAGCAGATGTGCGGAGGCGGCGGGCGAATGACCATTTTGTCGCTGGGCGAGCCG
GCCGTGTTTGAGCCGCCGCGAGTGGTGCCCAGCGTGGGCAACTGGACCTACTATGGCTGCGTCGAGGACAACATT
GGGCAGAAGCGCACCTTTTTCTGGCAGAGCTTCTCCGACGCCCTGACGCCCGCCTCGTGTCTGCATCGCTGCGCC
GAGTACGGCTACATGGCCGCCGGCCTCGAGTACGGGCGCGAGTGCTACTGCGGCGACGCTGCAAACATGGACACG
GCCGGGGCGCACGTGGTGGACGACAGCCAGTGCAACATTGCCTGCGCCGGCAACGCCTCGGCCCTGTGCGGCGGC
GGCAGCCGGCTGACCACGTACCTCTGGCGCGGCCCGACGCCCCTCTACTCTTGGACCTTTGCCGCGCCGGCAACG
CCCCAGGCCGGCTCGTACGACTTCCTCATTGGCGGCGTGTGCATCCCGCTCATGACGTCCCAGACCATCACCGGC
AAGGTCACCTTTCTCGAGAAATGGGGCACCGGCCCCCCAAACTCCACGGGCGCCTACGAGCTCGACCTGTCCCTC
GTCGCCAACGCCTCGGCCGCCTGGCGCGAGATGCACGTCAAGACGGACATCTTCTGTGCCGCCGGCGCCACCCTG
CCCGACCGCGCCGGCCGCCAGCTGACCGTGGGCGGATGGTCGGGCGACTCGACGTACGGAGTGCGCCTCTACACC
CCCGACGCCGCCGGCCGCAACGACTGGCAGGAGAATGTCGACGTGCTGCGCCTCAAGAACGGCCGCTGGTACCCG
TCCACCATGGTCATGGCCAACGGCTCCATCCTCGTCATTGGCGGCGAGCAAGGCTCCAACGGCGCTCCCGTGCCC
ACTCTGGAGCTGCTGCCGCCCCCTCCCGCCTCGCGCGCCCTCTACATGGACTGGCTGGAGCGCACCGACCCCAAC
AACCTCTATCCCTTTGTCTGCGTCCTGCCCTCGGGCGGCATCCTGGCCGTTTACTGGAACGAGGCCCGCATCCTC
AGCGACGTCGACTTCTCCACCATTCGCCTGCTGCCGCCCGTGCCCGGTGCCGTCAACGATGCCCGCGCCGGACGC
ACCTATCCCCTGGAAGGCGCTGCAGTCCTGCTCCCCCAACGCGCTCCCTACACCGAGCCTCTGGGCGTTTTGATT
TGCGGAGGCTCCAACGAGGGTCCCGCCAATGCCCTCGACAACTGCGTCTCCATCTACCCCGATGCCCCCAATGCC
CGCTGGGCCATTGAGCGCATGCCTTCGCCTCGCGTCATGCCCTGCATTGCGCCCCTGCCAGACGGCACCTACCTG
GTCCTCAACGGAGCCACTCATGGCGTTGCCGGCTTCGGCCTTGGCTCCGGCCCAAACCTCAACGCCCTGCTTTAC
AACCCCGCCAAGCCCCTGGGCAGTCGCTTCACCGTCATGGCCAACACATCCGTCGCTCGCATGTATCACTCAGAG
GCCATCACCCTGCTCGATGGCCGTGTTCTCGTCTCGGGCTCGGATCCTCAAGATGGCATCAATCCCCAAGAGTAT
CGCGTCGAGACCTTTACACCCCCATACCTCCTTGCCGGCAAGCGCCGACCAACCTTTAGCCTGGCCAACCAGACC
GACTGGCAATACGGCCAGCAGGTGCGCTTTACCCTGGGCAGCCTGCCTGTCAACGGCCCCATTTCAGTATCCCTG
CTTGGATCCGTCTCCAGCACCCATGGTAATTCCATGGGAGCTCGCACCATATTTCCCGCAGTCTCGTGTTCTGGT
ACCTCTTGCAGCGTTACTGCCCCGCCTGGAAAGTATATTTGCCCTCCTGGCTGGTACCAGTTCTTCCTTCTCGAC
GGGGGTATCCCCGCCGTCGGTGTTTTTGTCCGAATCGGAGGAGATCCGGCCGGCCTGGGAAAATGGCCCAAGGGC
CCTGGCTTCACAACTCCCGATTTGTAA
Gene >OphauG2|6026
ATGCCTGTCCCTGTAGAGAACCCAGGGTTGGATGGCTGGAAGTTTATGGGATGCCATTCGTGAGTTGCGAGATGG
GCGTGACTGATGAGGCCAAAGCGACTGATGGCTCTGGCATGACAGCGAGGGAGCCGAGGGACGCGCTCTGGGGCA
CGGCGTCAACACCGTCGCTGGAGACAACATGACAGTGGCCAGATGTCTGTCAGCATGCGGCACGGATGGATATGT
ACTGGCAGGCGTCGAGTATGGAGGCGAGTGCTGTAAGTGGGACGCGGCCTAGCTCGTGTGCATCGACTTGTCTCA
TGTGCGGACAGATTGCGGCCAAGGCCTGTCCAAGGGAGCAGCGCCAGCCGACAGCGGCTGCGATATCAGGTGCAG
GGGCAACAGCTCCGAGTACTGCGGAGGGGCCAGACGATTGTCTCTCTACTCGCACTCGGCCGCATCAGGCCTGTT
GGATATTGTGGAGCGGGCAATGCCAGCCGACAGCACCAGCACCAGCACCAACACCAGCATCAGCGCCACCTCGGC
CAGCCTAGCAGCGACCAACACAGCCACAGACGTGCCGGGCTTGCCCTCGGGATGGGCATCGTACGGCTGCTGGGT
CGATGGCGTCAACGGCCGTATCCTCAGCCAGCAGCTGGCCGACGACAGCAATCTGACAGTGCAGTCGTGCGCCTC
CAAGTGTGCTGGGCTCGGCTTCAGCGTGGCCGGAGCCGAATACCACAACCAGTGCTTCTGTGGCAAGCAAATCAT
CAATGGCGGCGTCCGCGCAAAGTCGGCGGCCGAGTGCGACACGCCGTGCAGCGGCGACAGCAAGCAGATGTGCGG
AGGCGGCGGGCGAATGACCATTTTGTCGCTGGGCGAGCCGGCCGTGTTTGAGCCGCCGCGAGTGGTGCCCAGCGT
GGGCAACTGGACCTACTATGGCTGCGTCGAGGACAACATTGGGCAGAAGCGCACCTTTTTCTGGCAGAGCTTCTC
CGACGCCCTGACGCCCGCCTCGTGTCTGCATCGCTGCGCCGAGTACGGCTACATGGCCGCCGGCCTCGAGTACGG
GCGCGAGTGCTACTGCGGCGACGCTGCAAACATGGACACGGCCGGGGCGCACGTGGTGGACGACAGCCAGTGCAA
CATTGCCTGCGCCGGCAACGCCTCGGCCCTGTGCGGCGGCGGCAGCCGGCTGACCACGTACCTCTGGCGCGGCCC
GACGCCCCTCTACTCTTGGACCTTTGCCGCGCCGGCAACGCCCCAGGCCGGCTCGTACGACTTCCTCATTGGCGG
CGTGTGCATCCCGCTCATGACGTCCCAGACCATCACCGGCAAGGTCACCTTTCTCGAGAAATGGGGCACCGGCCC
CCCAAACTCCACGGGCGCCTACGAGCTCGACCTGTCCCTCGTCGCCAACGCCTCGGCCGCCTGGCGCGAGATGCA
CGTCAAGACGGACATCTTCTGTGCCGCCGGCGCCACCCTGCCCGACCGCGCCGGCCGCCAGCTGACCGTGGGCGG
ATGGTCGGGCGACTCGACGTACGGAGTGCGCCTCTACACCCCCGACGCCGCCGGCCGCAACGACTGGCAGGAGAA
TGTCGACGTGCTGCGCCTCAAGAACGGCCGCTGGTACCCGTCCACCATGGTCATGGCCAACGGCTCCATCCTCGT
CATTGGCGGCGAGCAAGGCTCCAACGGCGCTCCCGTGCCCACTCTGGAGCTGCTGCCGCCCCCTCCCGCCTCGCG
CGCCCTCTACATGGACTGGCTGGAGCGCACCGACCCCAACAACCTCTATCCCTTTGTCTGCGTCCTGCCCTCGGG
CGGCATCCTGGCCGTTTACTGGAACGAGGCCCGCATCCTCAGCGACGTCGACTTCTCCACCATTCGCCTGCTGCC
GCCCGTGCCCGGTGCCGTCAACGATGCCCGCGCCGGACGCACCTATCCCCTGGAAGGCGCTGCAGTCCTGCTCCC
CCAACGCGCTCCCTACACCGAGCCTCTGGGCGTTTTGATTTGCGGAGGCTCCAACGAGGGTCCCGCCAATGCCCT
CGACAACTGCGTCTCCATCTACCCCGATGCCCCCAATGCCCGCTGGGCCATTGAGCGCATGCCTTCGCCTCGCGT
CATGCCCTGCATTGCGCCCCTGCCAGACGGCACCTACCTGGTCCTCAACGGAGCCACTCATGGCGTTGCCGGCTT
CGGCCTTGGCTCCGGCCCAAACCTCAACGCCCTGCTTTACAACCCCGCCAAGCCCCTGGGCAGTCGCTTCACCGT
CATGGCCAACACATCCGTCGCTCGCATGTATCACTCAGAGGCCATCACCCTGCTCGATGGCCGTGTTCTCGTCTC
GGGCTCGGATCCTCAAGATGGCATCAATCCCCAAGAGTATCGCGTCGAGACCTTTACACCCCCATACCTCCTTGC
CGGCAAGCGCCGACCAACCTTTAGCCTGGCCAACCAGACCGACTGGCAATACGGCCAGCAGGTGCGCTTTACCCT
GGGCAGCCTGCCTGTCAACGGCCCCATTTCAGTATCCCTGCTTGGATCCGTCTCCAGCACCCATGGTAATTCCAT
GGGAGCTCGCACCATATTTCCCGCAGTCTCGTGTTCTGGTACCTCTTGCAGCGTTACTGCCCCGCCTGGAAAGTA
TATTTGCCCTCCTGGCTGGTACCAGTTCTTCCTTCTCGACGGGGGTATCCCCGCCGTCGGTGTTTTTGTCCGAAT
CGGAGGAGATCCGGCCGGCCTGGGAAAATGGCCCAAGGGCCCTGGCTTCACAACTCCCGATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail