Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6023
Gene name
LocationContig_590:8277..8856
Strand+
Gene length (bp)579
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05603 DUF775 Protein of unknown function (DUF775) 5.0E-50 6 187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q29E01|OPI10_DROPS Protein OPI10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA12631 PE=3 SV=1 26 188 3.0E-16
sp|O60175|OPI10_SCHPO Protein OPI10 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21H7.06c PE=3 SV=1 6 191 1.0E-15
sp|Q08202|OPI10_YEAST Protein OPI10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI10 PE=1 SV=1 6 189 2.0E-15
sp|Q9W0C7|OPI10_DROME Protein OPI10 homolog OS=Drosophila melanogaster GN=CG13926 PE=3 SV=1 6 186 8.0E-14
sp|Q16RI1|OPI10_AEDAE Protein OPI10 homolog OS=Aedes aegypti GN=AAEL010953 PE=3 SV=1 8 188 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q29E01|OPI10_DROPS Protein OPI10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA12631 PE=3 SV=1 26 188 3.0E-16
sp|O60175|OPI10_SCHPO Protein OPI10 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21H7.06c PE=3 SV=1 6 191 1.0E-15
sp|Q08202|OPI10_YEAST Protein OPI10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI10 PE=1 SV=1 6 189 2.0E-15
sp|Q9W0C7|OPI10_DROME Protein OPI10 homolog OS=Drosophila melanogaster GN=CG13926 PE=3 SV=1 6 186 8.0E-14
sp|Q16RI1|OPI10_AEDAE Protein OPI10 homolog OS=Aedes aegypti GN=AAEL010953 PE=3 SV=1 8 188 4.0E-09
sp|Q7PRB5|OPI10_ANOGA Protein OPI10 homolog OS=Anopheles gambiae GN=AGAP002426 PE=3 SV=3 8 188 4.0E-09
sp|Q53FT3|HIKES_HUMAN Protein Hikeshi OS=Homo sapiens GN=C11orf73 PE=1 SV=2 6 186 4.0E-09
sp|Q568T4|HIKES_DANRE Protein Hikeshi OS=Danio rerio GN=zgc:110091 PE=2 SV=2 6 186 5.0E-09
sp|Q56JY0|HIKES_BOVIN Protein Hikeshi OS=Bos taurus PE=2 SV=1 6 186 6.0E-09
sp|Q5M808|HIKES_RAT Protein Hikeshi OS=Rattus norvegicus PE=2 SV=2 6 186 7.0E-09
sp|Q9DD02|HIKES_MOUSE Protein Hikeshi OS=Mus musculus GN=L7rn6 PE=1 SV=1 6 186 7.0E-09
sp|A4IGP0|HIKES_XENTR Protein Hikeshi OS=Xenopus tropicalis PE=2 SV=1 6 186 3.0E-08
sp|Q5ZK09|HIKES_CHICK Protein Hikeshi OS=Gallus gallus GN=RCJMB04_13p7 PE=2 SV=2 6 186 9.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6023 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1114
Ophiocordyceps kimflemingae Ophio5|1210
Ophiocordyceps subramaniannii Hirsu2|3986

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6023
MADTPLFGIVPTGQPLITVPSSTPDQSSLLYNLPVATFSHIVVFFLPNVALPNGTAASIYLSSVARNASNFIFLG
AIGPGKESAIFKLGSDWDATASGGLLLGITVENAESAALRVQELAASKTAPTLPRQPSTTVLAERIIQNAFNFLA
SFSGTIGPGGTEVVPLKAFEEWWKKFQSRIRSDPSFLEQQSD*
Coding >OphauG2|6023
ATGGCAGACACGCCTCTCTTCGGCATTGTGCCGACGGGTCAGCCACTCATCACAGTGCCATCTTCGACGCCAGAT
CAATCCTCGCTTCTCTACAATCTGCCCGTCGCAACCTTCTCTCATATTGTCGTCTTCTTTCTACCAAACGTCGCC
TTGCCCAATGGCACTGCTGCTTCTATTTATCTATCCTCGGTTGCCCGCAACGCCTCGAATTTCATCTTTCTTGGA
GCTATCGGCCCTGGCAAGGAGAGCGCCATCTTCAAGCTTGGCTCTGATTGGGATGCCACTGCTTCAGGCGGCTTA
TTGCTTGGAATTACAGTCGAGAATGCTGAGAGCGCTGCTCTGCGCGTACAGGAGCTCGCTGCATCAAAAACTGCC
CCTACGCTGCCGAGACAACCCTCTACCACTGTTCTAGCGGAGCGCATCATTCAAAATGCCTTTAACTTTTTAGCT
AGCTTCAGCGGTACCATAGGTCCTGGTGGTACGGAGGTTGTGCCTCTCAAAGCTTTTGAAGAATGGTGGAAGAAA
TTCCAATCTCGTATCCGGTCCGATCCTAGTTTCCTCGAGCAACAATCTGACTGA
Transcript >OphauG2|6023
ATGGCAGACACGCCTCTCTTCGGCATTGTGCCGACGGGTCAGCCACTCATCACAGTGCCATCTTCGACGCCAGAT
CAATCCTCGCTTCTCTACAATCTGCCCGTCGCAACCTTCTCTCATATTGTCGTCTTCTTTCTACCAAACGTCGCC
TTGCCCAATGGCACTGCTGCTTCTATTTATCTATCCTCGGTTGCCCGCAACGCCTCGAATTTCATCTTTCTTGGA
GCTATCGGCCCTGGCAAGGAGAGCGCCATCTTCAAGCTTGGCTCTGATTGGGATGCCACTGCTTCAGGCGGCTTA
TTGCTTGGAATTACAGTCGAGAATGCTGAGAGCGCTGCTCTGCGCGTACAGGAGCTCGCTGCATCAAAAACTGCC
CCTACGCTGCCGAGACAACCCTCTACCACTGTTCTAGCGGAGCGCATCATTCAAAATGCCTTTAACTTTTTAGCT
AGCTTCAGCGGTACCATAGGTCCTGGTGGTACGGAGGTTGTGCCTCTCAAAGCTTTTGAAGAATGGTGGAAGAAA
TTCCAATCTCGTATCCGGTCCGATCCTAGTTTCCTCGAGCAACAATCTGACTGA
Gene >OphauG2|6023
ATGGCAGACACGCCTCTCTTCGGCATTGTGCCGACGGGTCAGCCACTCATCACAGTGCCATCTTCGACGCCAGAT
CAATCCTCGCTTCTCTACAATCTGCCCGTCGCAACCTTCTCTCATATTGTCGTCTTCTTTCTACCAAACGTCGCC
TTGCCCAATGGCACTGCTGCTTCTATTTATCTATCCTCGGTTGCCCGCAACGCCTCGAATTTCATCTTTCTTGGA
GCTATCGGCCCTGGCAAGGAGAGCGCCATCTTCAAGCTTGGCTCTGATTGGGATGCCACTGCTTCAGGCGGCTTA
TTGCTTGGAATTACAGTCGAGAATGCTGAGAGCGCTGCTCTGCGCGTACAGGAGCTCGCTGCATCAAAAACTGCC
CCTACGCTGCCGAGACAACCCTCTACCACTGTTCTAGCGGAGCGCATCATTCAAAATGCCTTTAACTTTTTAGCT
AGCTTCAGCGGTACCATAGGTCCTGGTGGTACGGAGGTTGTGCCTCTCAAAGCTTTTGAAGAATGGTGGAAGAAA
TTCCAATCTCGTATCCGGTCCGATCCTAGTTTCCTCGAGCAACAATCTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail