Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6022
Gene name
LocationContig_590:6813..7947
Strand-
Gene length (bp)1134
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05625 PAXNEB PAXNEB protein 4.4E-94 33 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP1|ELP4_SCHPO Elongator complex protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp4 PE=3 SV=1 34 377 2.0E-38
sp|Q02884|ELP4_YEAST Elongator complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP4 PE=1 SV=1 33 321 3.0E-29
sp|Q2TBH6|ELP4_BOVIN Elongator complex protein 4 OS=Bos taurus GN=ELP4 PE=2 SV=1 33 372 8.0E-19
sp|Q9ER73|ELP4_MOUSE Elongator complex protein 4 OS=Mus musculus GN=Elp4 PE=1 SV=2 33 372 2.0E-18
sp|Q5XG58|ELP4_XENLA Elongator complex protein 4 OS=Xenopus laevis GN=elp4 PE=2 SV=1 34 365 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP1|ELP4_SCHPO Elongator complex protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp4 PE=3 SV=1 34 377 2.0E-38
sp|Q02884|ELP4_YEAST Elongator complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP4 PE=1 SV=1 33 321 3.0E-29
sp|Q2TBH6|ELP4_BOVIN Elongator complex protein 4 OS=Bos taurus GN=ELP4 PE=2 SV=1 33 372 8.0E-19
sp|Q9ER73|ELP4_MOUSE Elongator complex protein 4 OS=Mus musculus GN=Elp4 PE=1 SV=2 33 372 2.0E-18
sp|Q5XG58|ELP4_XENLA Elongator complex protein 4 OS=Xenopus laevis GN=elp4 PE=2 SV=1 34 365 1.0E-16
sp|Q96EB1|ELP4_HUMAN Elongator complex protein 4 OS=Homo sapiens GN=ELP4 PE=1 SV=2 33 373 2.0E-16
sp|Q566Y1|ELP4_DANRE Elongator complex protein 4 OS=Danio rerio GN=elp4 PE=2 SV=2 34 366 2.0E-15
sp|Q54XS0|ELP4_DICDI Probable elongator complex protein 4 OS=Dictyostelium discoideum GN=elp4 PE=3 SV=1 34 287 3.0E-10
sp|Q60ZM2|ELP4_CAEBR Putative elongator complex protein 4 OS=Caenorhabditis briggsae GN=elpc-4 PE=3 SV=1 46 377 1.0E-08
sp|Q9VMQ7|ELP4_DROME Putative elongator complex protein 4 OS=Drosophila melanogaster GN=CG6907 PE=1 SV=1 34 174 7.0E-07
sp|Q9C778|ELP4_ARATH Elongator complex protein 4 OS=Arabidopsis thaliana GN=ELP4 PE=1 SV=1 34 262 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0033588 elongator holoenzyme complex Yes
GO:0002098 tRNA wobble uridine modification Yes
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006399 tRNA metabolic process No
GO:0032991 protein-containing complex No
GO:0006400 tRNA modification No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008033 tRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0002097 tRNA wobble base modification No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6022
MSFRKRNTVIRATGSQRDPDKPSNAINHGLVSAGVRPSPLDGRPTTSTGTASLDQLLAGHAGLPLASSLLLEENG
TSDFSGVLLRYYAAEGLVQGHTIHVLGTDELVWRRQLPGLAKASTTENSSKISVPAEKMRIAWRYEALGGANKKA
SLPAGNTSAEPFCHSFDMSKHLDAAAVQGQVEFTNCITHAGGVPFSSFLDRLGSVLQKSPPSSIHRVLVPGLLSP
ALYSSAACQPQNVLQFLHGLRNLLRKFPNQATAMLTLPLPLYPRSSGLTRWMELLVDGVMELVPLNHRSLVTTGE
ADAKTQGLLKMHSYPVFHEKGGGLQDALCCQDLGFSLSALDGIVISPLSLPPLGSDETATKSSSEVVKETTQQKL
EF*
Coding >OphauG2|6022
ATGTCGTTTAGAAAGCGAAACACCGTCATTCGGGCGACAGGAAGCCAAAGGGACCCGGACAAGCCTTCCAATGCC
ATCAACCATGGTCTCGTGAGCGCTGGTGTTCGGCCGTCGCCTCTTGATGGAAGGCCAACAACGTCAACGGGCACT
GCTTCGCTGGACCAGTTATTAGCTGGACACGCCGGGCTGCCGCTTGCCTCCTCGCTCTTGCTGGAAGAGAACGGC
ACGAGCGATTTCTCAGGCGTCCTGCTCCGCTACTATGCTGCAGAGGGTCTGGTGCAAGGCCATACGATTCACGTG
CTTGGCACCGACGAGCTTGTATGGCGAAGACAGCTTCCTGGTCTGGCCAAGGCGTCTACAACTGAAAACTCCAGC
AAAATCTCTGTGCCGGCTGAAAAGATGAGGATCGCATGGAGATACGAGGCTCTGGGAGGCGCCAATAAGAAGGCC
TCGTTACCCGCTGGGAATACTTCTGCCGAGCCCTTCTGCCACTCTTTTGATATGAGCAAGCATCTCGACGCTGCC
GCAGTACAGGGCCAAGTTGAATTCACAAATTGCATCACGCACGCAGGAGGCGTTCCCTTTAGCTCTTTCCTTGAC
CGCCTTGGCTCTGTCTTGCAGAAATCGCCACCGTCGTCCATACACCGAGTTCTTGTGCCTGGCCTGCTATCGCCG
GCTCTGTATAGCTCAGCCGCTTGCCAACCGCAAAATGTATTACAGTTTCTACATGGCCTTAGAAATTTGCTGCGA
AAGTTCCCCAACCAAGCTACGGCCATGTTGACTCTACCCCTTCCGCTTTATCCTCGTTCCTCGGGCCTCACCCGT
TGGATGGAGCTGTTAGTCGACGGTGTCATGGAGCTGGTGCCTTTGAATCACCGTAGCCTCGTAACTACGGGCGAG
GCTGACGCCAAAACTCAGGGGCTGTTGAAGATGCATAGCTATCCAGTATTTCATGAAAAAGGGGGCGGCTTGCAA
GACGCCCTTTGCTGTCAAGACTTGGGCTTTAGCTTGAGCGCACTTGATGGCATTGTGATTTCTCCCTTGAGTCTT
CCTCCTCTTGGCAGTGACGAAACGGCTACCAAGTCGTCGTCTGAAGTAGTTAAAGAGACGACACAACAGAAGCTT
GAGTTTTAG
Transcript >OphauG2|6022
ATGTCGTTTAGAAAGCGAAACACCGTCATTCGGGCGACAGGAAGCCAAAGGGACCCGGACAAGCCTTCCAATGCC
ATCAACCATGGTCTCGTGAGCGCTGGTGTTCGGCCGTCGCCTCTTGATGGAAGGCCAACAACGTCAACGGGCACT
GCTTCGCTGGACCAGTTATTAGCTGGACACGCCGGGCTGCCGCTTGCCTCCTCGCTCTTGCTGGAAGAGAACGGC
ACGAGCGATTTCTCAGGCGTCCTGCTCCGCTACTATGCTGCAGAGGGTCTGGTGCAAGGCCATACGATTCACGTG
CTTGGCACCGACGAGCTTGTATGGCGAAGACAGCTTCCTGGTCTGGCCAAGGCGTCTACAACTGAAAACTCCAGC
AAAATCTCTGTGCCGGCTGAAAAGATGAGGATCGCATGGAGATACGAGGCTCTGGGAGGCGCCAATAAGAAGGCC
TCGTTACCCGCTGGGAATACTTCTGCCGAGCCCTTCTGCCACTCTTTTGATATGAGCAAGCATCTCGACGCTGCC
GCAGTACAGGGCCAAGTTGAATTCACAAATTGCATCACGCACGCAGGAGGCGTTCCCTTTAGCTCTTTCCTTGAC
CGCCTTGGCTCTGTCTTGCAGAAATCGCCACCGTCGTCCATACACCGAGTTCTTGTGCCTGGCCTGCTATCGCCG
GCTCTGTATAGCTCAGCCGCTTGCCAACCGCAAAATGTATTACAGTTTCTACATGGCCTTAGAAATTTGCTGCGA
AAGTTCCCCAACCAAGCTACGGCCATGTTGACTCTACCCCTTCCGCTTTATCCTCGTTCCTCGGGCCTCACCCGT
TGGATGGAGCTGTTAGTCGACGGTGTCATGGAGCTGGTGCCTTTGAATCACCGTAGCCTCGTAACTACGGGCGAG
GCTGACGCCAAAACTCAGGGGCTGTTGAAGATGCATAGCTATCCAGTATTTCATGAAAAAGGGGGCGGCTTGCAA
GACGCCCTTTGCTGTCAAGACTTGGGCTTTAGCTTGAGCGCACTTGATGGCATTGTGATTTCTCCCTTGAGTCTT
CCTCCTCTTGGCAGTGACGAAACGGCTACCAAGTCGTCGTCTGAAGTAGTTAAAGAGACGACACAACAGAAGCTT
GAGTTTTAG
Gene >OphauG2|6022
ATGTCGTTTAGAAAGCGAAACACCGTCATTCGGGCGACAGGAAGCCAAAGGGACCCGGACAAGCCTTCCAATGCC
ATCAACCATGGTCTCGTGAGCGCTGGTGTTCGGCCGTCGCCTCTTGATGGAAGGCCAACAACGTCAACGGGCACT
GCTTCGCTGGACCAGTTATTAGCTGGACACGCCGGGCTGCCGCTTGCCTCCTCGCTCTTGCTGGAAGAGAACGGC
ACGAGCGATTTCTCAGGCGTCCTGCTCCGCTACTATGCTGCAGAGGGTCTGGTGCAAGGCCATACGATTCACGTG
CTTGGCACCGACGAGCTTGTATGGCGAAGACAGCTTCCTGGTCTGGCCAAGGCGTCTACAACTGAAAACTCCAGC
AAAATCTCTGTGCCGGCTGAAAAGATGAGGATCGCATGGAGATACGAGGCTCTGGGAGGCGCCAATAAGAAGGCC
TCGTTACCCGCTGGGAATACTTCTGCCGAGCCCTTCTGCCACTCTTTTGATATGAGCAAGCATCTCGACGCTGCC
GCAGTACAGGGCCAAGTTGAATTCACAAATTGCATCACGCACGCAGGAGGCGTTCCCTTTAGCTCTTTCCTTGAC
CGCCTTGGCTCTGTCTTGCAGAAATCGCCACCGTCGTCCATACACCGAGTTCTTGTGCCTGGCCTGCTATCGCCG
GCTCTGTATAGCTCAGCCGCTTGCCAACCGCAAAATGTATTACAGTTTCTACATGGCCTTAGAAATTTGCTGCGA
AAGTTCCCCAACCAAGCTACGGCCATGTTGACTCTACCCCTTCCGCTTTATCCTCGTTCCTCGGGCCTCACCCGT
TGGATGGAGCTGTTAGTCGACGGTGTCATGGAGCTGGTGCCTTTGAATCACCGTAGCCTCGTAACTACGGGCGAG
GCTGACGCCAAAACTCAGGGGCTGTTGAAGATGCATAGCTATCCAGTATTTCATGAAAAAGGGGGCGGCTTGCAA
GACGCCCTTTGCTGTCAAGACTTGGGCTTTAGCTTGAGCGCACTTGATGGCATTGTGATTTCTCCCTTGAGTCTT
CCTCCTCTTGGCAGTGACGAAACGGCTACCAAGTCGTCGTCTGAAGTAGTTAAAGAGACGACACAACAGAAGCTT
GAGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail