Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6021
Gene name
LocationContig_590:3496..6271
Strand-
Gene length (bp)2775
Transcript length (bp)2775
Coding sequence length (bp)2775
Protein length (aa) 925

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 4.5E-08 870 916

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P54074|ASI1_YEAST Protein ASI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASI1 PE=1 SV=1 836 921 2.0E-12
sp|P53983|ASI3_YEAST Protein ASI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASI3 PE=1 SV=2 872 921 2.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 345 367 22
2 388 410 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6021 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1112
Ophiocordyceps subramaniannii Hirsu2|3113

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6021
MDREPDSILSDFDGASASGLYHVVAWAANATSFFITKLIAQPPLEAASLHSLSMGASDPTVLTAASDSPSASASL
SPGQETMMPASRLSLDGSRGLSSVFNYAVSKWALSCVAMAIVLNRTHIFAATRRRLHLRWPVRLAVRLVPIVLLT
LQVGRLLQSIQCQTSSSFARLHSANATFSRPNPLLNTLSSALLLGATDEHSCTAFYTTFASDIPPHSTRFHGSLS
LLWPLFGTFCLSHLLETLMAAVQGLPMVSQTGMTLFEQSLAFAEADASVMNQLGRTALSSASSVLAHSSSGLDPE
MALTGSAILTQANAAPEVLLVALLSSMAHISSHVLGIFDLQAKHRLFNTGFWAICFMASIIVTALSFDPDDTSSQ
GLLRFPTVCIISFIPHVLVLAGVATCLCIYFFGLVLSALAPPAHRQLPPLTFRQRFAYAQRNMQANLSISDIRIT
ADMDFYTALLRTGFAAMTMASEAVYLNEDRGVSLKKRTWLEEARLRDLEELQRRCVGLGLPGSRYDQIGTVGLIP
IKDSSVSACNGYNRERAAQVLPKGRSERGIRVGTGATERSSRWIMALEFLLSIWQLMVRVGALSGLWALGLVRIR
ARPAWLLWLARRSKPASNTGRRQRYPQDAPLSDNQPTSELHLDERSDYDDEHKSKGNGLDVEEEFRRVRPSSNEE
AFDHDLYLYWLNGGWWGSRDSSGDFNPMPAEDDWDATSVVSVTSDGQTLDAEWESESDGQKTPTRASPRPRASRE
NSPFLDSPLSINDLARLLRPTSRQDREEALTLATHLQTDKIITRARFSQLDRLRRARVLATSGTRANSGLESLAP
YTKLGPDEEERLLEQLLLSHRRQSRPRNTTEPLEGTSSDDSAEGRPCVVCQTSMRTIIVWPCRCLSLCDDCRVSL
AMNNFDKCVCCRRDVMSFSRIFVP*
Coding >OphauG2|6021
ATGGACCGTGAGCCCGACTCAATCCTCTCGGATTTCGATGGCGCGTCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACCTCATTCTTTATCACAAAGCTTATAGCCCAGCCACCCCTTGAAGCTGCTTCGTTGCAT
TCCCTGAGCATGGGCGCCTCAGACCCCACGGTTCTGACGGCCGCCTCTGATTCTCCCTCAGCCTCGGCCTCTCTC
TCGCCCGGTCAAGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTGAGCAGCGTCTTC
AATTATGCTGTCAGCAAATGGGCCCTCTCATGCGTCGCCATGGCTATCGTCCTCAACCGCACCCATATCTTTGCT
GCCACACGTCGTCGCTTGCATCTGCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAATTGTACTCTTGACG
CTTCAAGTTGGCCGTCTTCTCCAATCGATCCAGTGCCAGACCTCCTCGTCCTTTGCCCGTCTGCACTCGGCCAAC
GCCACCTTCTCGCGCCCGAATCCCCTCCTCAACACCCTGAGCTCGGCATTGCTCCTGGGCGCCACAGACGAGCAC
TCTTGCACCGCCTTTTACACGACATTTGCCTCCGATATACCCCCTCACTCGACCCGATTTCACGGATCGCTTTCA
CTTCTGTGGCCATTGTTCGGCACGTTTTGCCTTAGCCACCTACTCGAAACTCTCATGGCAGCCGTTCAGGGCTTG
CCCATGGTATCGCAGACGGGAATGACTCTCTTTGAACAGTCGCTGGCTTTTGCCGAGGCTGATGCCTCCGTCATG
AACCAACTGGGCCGGACAGCTTTGTCCAGTGCCTCGTCCGTCTTGGCCCATAGCTCCTCGGGCCTTGACCCTGAA
ATGGCTTTAACCGGCTCTGCCATACTTACCCAAGCCAATGCAGCCCCAGAGGTACTTTTGGTGGCTTTGCTATCG
TCAATGGCCCATATCAGCAGCCATGTTCTTGGAATATTTGACCTCCAGGCAAAACATAGGCTTTTTAATACCGGC
TTCTGGGCTATTTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCTGACGACACATCCAGTCAG
GGACTGCTTAGATTTCCAACAGTTTGCATCATCAGTTTCATCCCACATGTTCTTGTCCTGGCCGGAGTTGCAACC
TGTTTATGTATCTATTTCTTCGGCCTGGTACTCTCAGCTTTAGCCCCTCCAGCACATCGTCAACTCCCCCCCTTG
ACTTTTCGTCAACGTTTTGCTTACGCACAACGCAACATGCAGGCCAATCTGTCGATATCCGACATTAGAATCACG
GCCGACATGGACTTCTATACCGCATTGCTGAGGACGGGCTTTGCTGCCATGACCATGGCCAGCGAGGCAGTCTAT
CTGAACGAGGATCGTGGTGTCAGCCTGAAAAAGCGAACTTGGCTAGAGGAGGCACGTTTACGCGACCTTGAAGAA
CTACAGAGGCGTTGCGTTGGCCTTGGACTGCCTGGCTCCCGCTACGACCAGATTGGCACTGTTGGTCTCATACCA
ATCAAGGACTCGTCGGTCTCCGCTTGCAACGGGTATAATAGGGAGCGCGCTGCTCAAGTTTTACCCAAAGGCCGC
AGCGAACGTGGTATCCGCGTAGGTACTGGAGCGACCGAGAGGAGCTCGAGGTGGATCATGGCATTAGAATTCCTC
TTGAGCATATGGCAGCTCATGGTCCGGGTTGGCGCTCTATCTGGCCTTTGGGCTCTCGGCCTCGTGCGCATCCGG
GCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAACCAGCGAGCAACACCGGTCGGCGCCAAAGATAT
CCCCAAGACGCACCTTTAAGTGACAACCAACCCACTTCAGAATTACACCTAGACGAGCGCAGTGATTACGACGAC
GAACACAAATCCAAGGGCAACGGTCTCGACGTGGAAGAAGAATTCAGACGTGTTAGACCCTCGAGCAATGAAGAG
GCGTTCGATCATGACTTATATTTATACTGGCTCAATGGCGGTTGGTGGGGTTCTCGCGACTCCAGTGGCGACTTC
AATCCCATGCCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGTGACGGGCAGACTTTGGAC
GCGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCGAGCTTCGCCACGGCCACGCGCCTCACGTGAA
AACAGTCCATTTCTCGATAGTCCCCTAAGCATAAACGATCTTGCCCGATTACTGCGTCCAACAAGTCGCCAAGAC
CGCGAAGAGGCACTAACCCTGGCGACGCATTTGCAAACAGACAAGATTATAACGAGGGCGCGTTTCTCGCAGCTG
GACCGACTAAGGCGTGCTCGTGTCCTGGCAACGTCGGGCACTCGAGCCAATAGTGGCCTTGAGTCTCTGGCGCCC
TACACCAAGCTCGGTCCTGACGAGGAGGAACGCTTGCTTGAGCAGCTTTTACTCTCTCATCGCCGCCAGTCAAGG
CCGAGAAACACGACCGAGCCGCTTGAGGGCACGTCAAGCGACGATTCGGCCGAGGGCCGCCCCTGTGTCGTGTGC
CAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGCTGTCTGAGCTTATGCGATGACTGCCGCGTATCGCTG
GCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGGCGAGATGTCATGAGCTTTAGTCGTATCTTTGTTCCATGA
Transcript >OphauG2|6021
ATGGACCGTGAGCCCGACTCAATCCTCTCGGATTTCGATGGCGCGTCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACCTCATTCTTTATCACAAAGCTTATAGCCCAGCCACCCCTTGAAGCTGCTTCGTTGCAT
TCCCTGAGCATGGGCGCCTCAGACCCCACGGTTCTGACGGCCGCCTCTGATTCTCCCTCAGCCTCGGCCTCTCTC
TCGCCCGGTCAAGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTGAGCAGCGTCTTC
AATTATGCTGTCAGCAAATGGGCCCTCTCATGCGTCGCCATGGCTATCGTCCTCAACCGCACCCATATCTTTGCT
GCCACACGTCGTCGCTTGCATCTGCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAATTGTACTCTTGACG
CTTCAAGTTGGCCGTCTTCTCCAATCGATCCAGTGCCAGACCTCCTCGTCCTTTGCCCGTCTGCACTCGGCCAAC
GCCACCTTCTCGCGCCCGAATCCCCTCCTCAACACCCTGAGCTCGGCATTGCTCCTGGGCGCCACAGACGAGCAC
TCTTGCACCGCCTTTTACACGACATTTGCCTCCGATATACCCCCTCACTCGACCCGATTTCACGGATCGCTTTCA
CTTCTGTGGCCATTGTTCGGCACGTTTTGCCTTAGCCACCTACTCGAAACTCTCATGGCAGCCGTTCAGGGCTTG
CCCATGGTATCGCAGACGGGAATGACTCTCTTTGAACAGTCGCTGGCTTTTGCCGAGGCTGATGCCTCCGTCATG
AACCAACTGGGCCGGACAGCTTTGTCCAGTGCCTCGTCCGTCTTGGCCCATAGCTCCTCGGGCCTTGACCCTGAA
ATGGCTTTAACCGGCTCTGCCATACTTACCCAAGCCAATGCAGCCCCAGAGGTACTTTTGGTGGCTTTGCTATCG
TCAATGGCCCATATCAGCAGCCATGTTCTTGGAATATTTGACCTCCAGGCAAAACATAGGCTTTTTAATACCGGC
TTCTGGGCTATTTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCTGACGACACATCCAGTCAG
GGACTGCTTAGATTTCCAACAGTTTGCATCATCAGTTTCATCCCACATGTTCTTGTCCTGGCCGGAGTTGCAACC
TGTTTATGTATCTATTTCTTCGGCCTGGTACTCTCAGCTTTAGCCCCTCCAGCACATCGTCAACTCCCCCCCTTG
ACTTTTCGTCAACGTTTTGCTTACGCACAACGCAACATGCAGGCCAATCTGTCGATATCCGACATTAGAATCACG
GCCGACATGGACTTCTATACCGCATTGCTGAGGACGGGCTTTGCTGCCATGACCATGGCCAGCGAGGCAGTCTAT
CTGAACGAGGATCGTGGTGTCAGCCTGAAAAAGCGAACTTGGCTAGAGGAGGCACGTTTACGCGACCTTGAAGAA
CTACAGAGGCGTTGCGTTGGCCTTGGACTGCCTGGCTCCCGCTACGACCAGATTGGCACTGTTGGTCTCATACCA
ATCAAGGACTCGTCGGTCTCCGCTTGCAACGGGTATAATAGGGAGCGCGCTGCTCAAGTTTTACCCAAAGGCCGC
AGCGAACGTGGTATCCGCGTAGGTACTGGAGCGACCGAGAGGAGCTCGAGGTGGATCATGGCATTAGAATTCCTC
TTGAGCATATGGCAGCTCATGGTCCGGGTTGGCGCTCTATCTGGCCTTTGGGCTCTCGGCCTCGTGCGCATCCGG
GCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAACCAGCGAGCAACACCGGTCGGCGCCAAAGATAT
CCCCAAGACGCACCTTTAAGTGACAACCAACCCACTTCAGAATTACACCTAGACGAGCGCAGTGATTACGACGAC
GAACACAAATCCAAGGGCAACGGTCTCGACGTGGAAGAAGAATTCAGACGTGTTAGACCCTCGAGCAATGAAGAG
GCGTTCGATCATGACTTATATTTATACTGGCTCAATGGCGGTTGGTGGGGTTCTCGCGACTCCAGTGGCGACTTC
AATCCCATGCCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGTGACGGGCAGACTTTGGAC
GCGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCGAGCTTCGCCACGGCCACGCGCCTCACGTGAA
AACAGTCCATTTCTCGATAGTCCCCTAAGCATAAACGATCTTGCCCGATTACTGCGTCCAACAAGTCGCCAAGAC
CGCGAAGAGGCACTAACCCTGGCGACGCATTTGCAAACAGACAAGATTATAACGAGGGCGCGTTTCTCGCAGCTG
GACCGACTAAGGCGTGCTCGTGTCCTGGCAACGTCGGGCACTCGAGCCAATAGTGGCCTTGAGTCTCTGGCGCCC
TACACCAAGCTCGGTCCTGACGAGGAGGAACGCTTGCTTGAGCAGCTTTTACTCTCTCATCGCCGCCAGTCAAGG
CCGAGAAACACGACCGAGCCGCTTGAGGGCACGTCAAGCGACGATTCGGCCGAGGGCCGCCCCTGTGTCGTGTGC
CAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGCTGTCTGAGCTTATGCGATGACTGCCGCGTATCGCTG
GCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGGCGAGATGTCATGAGCTTTAGTCGTATCTTTGTTCCATGA
Gene >OphauG2|6021
ATGGACCGTGAGCCCGACTCAATCCTCTCGGATTTCGATGGCGCGTCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACCTCATTCTTTATCACAAAGCTTATAGCCCAGCCACCCCTTGAAGCTGCTTCGTTGCAT
TCCCTGAGCATGGGCGCCTCAGACCCCACGGTTCTGACGGCCGCCTCTGATTCTCCCTCAGCCTCGGCCTCTCTC
TCGCCCGGTCAAGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTGAGCAGCGTCTTC
AATTATGCTGTCAGCAAATGGGCCCTCTCATGCGTCGCCATGGCTATCGTCCTCAACCGCACCCATATCTTTGCT
GCCACACGTCGTCGCTTGCATCTGCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAATTGTACTCTTGACG
CTTCAAGTTGGCCGTCTTCTCCAATCGATCCAGTGCCAGACCTCCTCGTCCTTTGCCCGTCTGCACTCGGCCAAC
GCCACCTTCTCGCGCCCGAATCCCCTCCTCAACACCCTGAGCTCGGCATTGCTCCTGGGCGCCACAGACGAGCAC
TCTTGCACCGCCTTTTACACGACATTTGCCTCCGATATACCCCCTCACTCGACCCGATTTCACGGATCGCTTTCA
CTTCTGTGGCCATTGTTCGGCACGTTTTGCCTTAGCCACCTACTCGAAACTCTCATGGCAGCCGTTCAGGGCTTG
CCCATGGTATCGCAGACGGGAATGACTCTCTTTGAACAGTCGCTGGCTTTTGCCGAGGCTGATGCCTCCGTCATG
AACCAACTGGGCCGGACAGCTTTGTCCAGTGCCTCGTCCGTCTTGGCCCATAGCTCCTCGGGCCTTGACCCTGAA
ATGGCTTTAACCGGCTCTGCCATACTTACCCAAGCCAATGCAGCCCCAGAGGTACTTTTGGTGGCTTTGCTATCG
TCAATGGCCCATATCAGCAGCCATGTTCTTGGAATATTTGACCTCCAGGCAAAACATAGGCTTTTTAATACCGGC
TTCTGGGCTATTTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCTGACGACACATCCAGTCAG
GGACTGCTTAGATTTCCAACAGTTTGCATCATCAGTTTCATCCCACATGTTCTTGTCCTGGCCGGAGTTGCAACC
TGTTTATGTATCTATTTCTTCGGCCTGGTACTCTCAGCTTTAGCCCCTCCAGCACATCGTCAACTCCCCCCCTTG
ACTTTTCGTCAACGTTTTGCTTACGCACAACGCAACATGCAGGCCAATCTGTCGATATCCGACATTAGAATCACG
GCCGACATGGACTTCTATACCGCATTGCTGAGGACGGGCTTTGCTGCCATGACCATGGCCAGCGAGGCAGTCTAT
CTGAACGAGGATCGTGGTGTCAGCCTGAAAAAGCGAACTTGGCTAGAGGAGGCACGTTTACGCGACCTTGAAGAA
CTACAGAGGCGTTGCGTTGGCCTTGGACTGCCTGGCTCCCGCTACGACCAGATTGGCACTGTTGGTCTCATACCA
ATCAAGGACTCGTCGGTCTCCGCTTGCAACGGGTATAATAGGGAGCGCGCTGCTCAAGTTTTACCCAAAGGCCGC
AGCGAACGTGGTATCCGCGTAGGTACTGGAGCGACCGAGAGGAGCTCGAGGTGGATCATGGCATTAGAATTCCTC
TTGAGCATATGGCAGCTCATGGTCCGGGTTGGCGCTCTATCTGGCCTTTGGGCTCTCGGCCTCGTGCGCATCCGG
GCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAACCAGCGAGCAACACCGGTCGGCGCCAAAGATAT
CCCCAAGACGCACCTTTAAGTGACAACCAACCCACTTCAGAATTACACCTAGACGAGCGCAGTGATTACGACGAC
GAACACAAATCCAAGGGCAACGGTCTCGACGTGGAAGAAGAATTCAGACGTGTTAGACCCTCGAGCAATGAAGAG
GCGTTCGATCATGACTTATATTTATACTGGCTCAATGGCGGTTGGTGGGGTTCTCGCGACTCCAGTGGCGACTTC
AATCCCATGCCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGTGACGGGCAGACTTTGGAC
GCGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCGAGCTTCGCCACGGCCACGCGCCTCACGTGAA
AACAGTCCATTTCTCGATAGTCCCCTAAGCATAAACGATCTTGCCCGATTACTGCGTCCAACAAGTCGCCAAGAC
CGCGAAGAGGCACTAACCCTGGCGACGCATTTGCAAACAGACAAGATTATAACGAGGGCGCGTTTCTCGCAGCTG
GACCGACTAAGGCGTGCTCGTGTCCTGGCAACGTCGGGCACTCGAGCCAATAGTGGCCTTGAGTCTCTGGCGCCC
TACACCAAGCTCGGTCCTGACGAGGAGGAACGCTTGCTTGAGCAGCTTTTACTCTCTCATCGCCGCCAGTCAAGG
CCGAGAAACACGACCGAGCCGCTTGAGGGCACGTCAAGCGACGATTCGGCCGAGGGCCGCCCCTGTGTCGTGTGC
CAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGCTGTCTGAGCTTATGCGATGACTGCCGCGTATCGCTG
GCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGGCGAGATGTCATGAGCTTTAGTCGTATCTTTGTTCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail