Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6013
Gene name
LocationContig_59:26185..27271
Strand+
Gene length (bp)1086
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04502 Saf4_Yju2 Saf4/Yju2 protein 3.6E-53 8 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60141|CWC16_SCHPO Protein saf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=saf4 PE=3 SV=2 1 209 8.0E-39
sp|Q7K0F0|CC130_DROME Coiled-coil domain-containing protein 130 homolog OS=Drosophila melanogaster GN=CG15084 PE=2 SV=1 7 217 3.0E-31
sp|Q5EA37|CC130_BOVIN Coiled-coil domain-containing protein 130 OS=Bos taurus GN=CCDC130 PE=2 SV=1 31 211 1.0E-30
sp|P13994|CC130_HUMAN Coiled-coil domain-containing protein 130 OS=Homo sapiens GN=CCDC130 PE=1 SV=2 31 211 2.0E-30
sp|Q6DJK9|CC130_XENLA Coiled-coil domain-containing protein 130 OS=Xenopus laevis GN=ccdc130 PE=2 SV=1 7 221 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60141|CWC16_SCHPO Protein saf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=saf4 PE=3 SV=2 1 209 8.0E-39
sp|Q7K0F0|CC130_DROME Coiled-coil domain-containing protein 130 homolog OS=Drosophila melanogaster GN=CG15084 PE=2 SV=1 7 217 3.0E-31
sp|Q5EA37|CC130_BOVIN Coiled-coil domain-containing protein 130 OS=Bos taurus GN=CCDC130 PE=2 SV=1 31 211 1.0E-30
sp|P13994|CC130_HUMAN Coiled-coil domain-containing protein 130 OS=Homo sapiens GN=CCDC130 PE=1 SV=2 31 211 2.0E-30
sp|Q6DJK9|CC130_XENLA Coiled-coil domain-containing protein 130 OS=Xenopus laevis GN=ccdc130 PE=2 SV=1 7 221 6.0E-30
sp|Q9D516|CC130_MOUSE Coiled-coil domain-containing protein 130 OS=Mus musculus GN=Ccdc130 PE=2 SV=1 30 211 6.0E-30
sp|Q32PZ9|CC130_RAT Coiled-coil domain-containing protein 130 OS=Rattus norvegicus GN=Ccdc130 PE=2 SV=1 31 211 1.0E-29
sp|Q66I85|CC130_DANRE Coiled-coil domain-containing protein 130 homolog OS=Danio rerio GN=ccdc130 PE=2 SV=1 31 211 4.0E-26
sp|Q54TR4|CC130_DICDI Coiled-coil domain-containing protein 130 homolog OS=Dictyostelium discoideum GN=DDB_G0281599 PE=3 SV=1 7 105 2.0E-19
sp|Q09651|CC130_CAEEL Coiled-coil domain-containing protein 130 homolog OS=Caenorhabditis elegans GN=ZK1307.9 PE=1 SV=1 30 209 7.0E-19
sp|Q9P7C5|CWF16_SCHPO Pre-mRNA-splicing factor cwf16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf16 PE=1 SV=2 6 104 1.0E-14
sp|Q54WR5|CCD94_DICDI Coiled-coil domain-containing protein 94 homolog OS=Dictyostelium discoideum GN=ccdc94 PE=3 SV=1 6 104 1.0E-13
sp|Q9D6J3|CCD94_MOUSE Coiled-coil domain-containing protein 94 OS=Mus musculus GN=Ccdc94 PE=1 SV=1 6 104 3.0E-13
sp|Q9BW85|CCD94_HUMAN Coiled-coil domain-containing protein 94 OS=Homo sapiens GN=CCDC94 PE=1 SV=1 6 104 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0016071 mRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0006397 mRNA processing No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008380 RNA splicing No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6821
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6013 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1817
Ophiocordyceps camponoti-floridani Ophcf2|01495
Ophiocordyceps kimflemingae Ophio5|3561

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6013
MQGFNMGRYHPPDSDSSCPPGRRKPPQTPTVRFEMPFAIWCSTCAQPTLIGQGVRFNARKKRVGAYYSTPVYRFS
MRHGECGGEIEIETEPARTDYVVVTGGRRRDYGHDAPPSSPPIDKQSAFSTLERTIAHRSALAASHSRIQALAEA
QDATWSDPYARNQRLRAALRPARRERLRQRLRDAQMAQLAPDLVLLDPSEEDARQAALVEFGAKRELSGHETDVD
WQDAEPRLAADKDGASMNAAISLSPDAPLAKPLFHNTSRHASSLASANPSRHASSLASAIASKTRLAHDPFVQSA
SAHFSRRKKPHRKHAQPEAAPKAGSSSLLVQYDSD*
Coding >OphauG2|6013
ATGCAAGGCTTCAACATGGGCCGCTACCACCCTCCCGACTCCGACTCCTCCTGCCCCCCTGGGCGTCGCAAGCCG
CCGCAAACACCAACTGTCCGCTTCGAAATGCCCTTTGCCATTTGGTGCTCGACGTGTGCGCAACCCACGCTGATT
GGGCAAGGGGTGCGCTTCAATGCGCGCAAGAAGCGCGTGGGCGCATACTACTCAACGCCCGTGTATAGGTTTAGC
ATGAGGCATGGGGAATGTGGAGGCGAGATTGAGATTGAGACGGAGCCGGCGAGGACGGATTATGTGGTTGTGACT
GGAGGGCGACGGCGGGATTATGGACATGATGCACCGCCCTCGTCTCCCCCAATAGACAAACAATCCGCCTTTTCC
ACGCTCGAACGCACCATTGCCCACCGCTCTGCCCTCGCCGCCTCGCACTCGCGCATCCAGGCCCTCGCCGAGGCC
CAAGACGCCACTTGGTCGGATCCCTATGCGCGCAACCAGCGCCTGCGCGCCGCCCTGCGTCCTGCTCGTCGCGAG
CGCCTGCGCCAGCGTCTCCGTGACGCGCAAATGGCGCAGCTGGCCCCGGATCTTGTTCTCCTCGACCCGAGCGAG
GAGGATGCGCGGCAGGCTGCGCTTGTCGAATTCGGCGCCAAAAGGGAGCTGAGCGGACATGAAACCGACGTCGAC
TGGCAAGATGCTGAACCGAGACTGGCTGCAGACAAGGATGGCGCGTCGATGAATGCTGCCATTTCCCTTTCTCCA
GATGCTCCCCTCGCCAAACCCCTCTTTCACAATACTTCTCGTCACGCCTCTTCTCTTGCCTCGGCCAATCCCTCT
CGCCACGCCTCTTCTCTTGCCTCGGCCATTGCCTCAAAGACTCGCCTTGCCCACGACCCCTTTGTCCAATCTGCC
AGCGCGCACTTTTCCCGACGAAAGAAGCCGCACCGCAAACATGCTCAACCCGAGGCGGCGCCCAAAGCCGGGTCG
TCGTCTCTGCTGGTGCAGTACGACTCTGATTGA
Transcript >OphauG2|6013
ATGCAAGGCTTCAACATGGGCCGCTACCACCCTCCCGACTCCGACTCCTCCTGCCCCCCTGGGCGTCGCAAGCCG
CCGCAAACACCAACTGTCCGCTTCGAAATGCCCTTTGCCATTTGGTGCTCGACGTGTGCGCAACCCACGCTGATT
GGGCAAGGGGTGCGCTTCAATGCGCGCAAGAAGCGCGTGGGCGCATACTACTCAACGCCCGTGTATAGGTTTAGC
ATGAGGCATGGGGAATGTGGAGGCGAGATTGAGATTGAGACGGAGCCGGCGAGGACGGATTATGTGGTTGTGACT
GGAGGGCGACGGCGGGATTATGGACATGATGCACCGCCCTCGTCTCCCCCAATAGACAAACAATCCGCCTTTTCC
ACGCTCGAACGCACCATTGCCCACCGCTCTGCCCTCGCCGCCTCGCACTCGCGCATCCAGGCCCTCGCCGAGGCC
CAAGACGCCACTTGGTCGGATCCCTATGCGCGCAACCAGCGCCTGCGCGCCGCCCTGCGTCCTGCTCGTCGCGAG
CGCCTGCGCCAGCGTCTCCGTGACGCGCAAATGGCGCAGCTGGCCCCGGATCTTGTTCTCCTCGACCCGAGCGAG
GAGGATGCGCGGCAGGCTGCGCTTGTCGAATTCGGCGCCAAAAGGGAGCTGAGCGGACATGAAACCGACGTCGAC
TGGCAAGATGCTGAACCGAGACTGGCTGCAGACAAGGATGGCGCGTCGATGAATGCTGCCATTTCCCTTTCTCCA
GATGCTCCCCTCGCCAAACCCCTCTTTCACAATACTTCTCGTCACGCCTCTTCTCTTGCCTCGGCCAATCCCTCT
CGCCACGCCTCTTCTCTTGCCTCGGCCATTGCCTCAAAGACTCGCCTTGCCCACGACCCCTTTGTCCAATCTGCC
AGCGCGCACTTTTCCCGACGAAAGAAGCCGCACCGCAAACATGCTCAACCCGAGGCGGCGCCCAAAGCCGGGTCG
TCGTCTCTGCTGGTGCAGTACGACTCTGATTGA
Gene >OphauG2|6013
ATGCAAGGCTTCAACATGGGCCGCTACCACCCTCCCGACTCCGACTCCTCCTGCCCCCCTGGGCGTCGCAAGCCG
CCGCAAACACCAACTGTCCGCTTCGAAATGCCCTTTGCCATTTGGTGCTCGACGTGTGCGCAACCCACGCTGATT
GGGCAAGGGGTGCGCTTCAATGCGCGCAAGAAGCGCGTGGGCGCATACTACTCAACGCCCGTGTATAGGTTTAGC
ATGAGGCATGGGGAATGTGGAGGCGAGATTGAGATTGAGACGGAGCCGGCGAGGACGGATTATGTGGTTGTGACT
GGAGGGCGACGGCGGGATTATGGACATGGTGAGTTTTTTTTCTTTTTTTTTTCCCTTTTTTTTTTCATAAAAAAA
AGTGCTCGACTTTAGCCAACCCTTTTTGCAGATGCACCGCCCTCGTCTCCCCCAATAGACAAACAATCCGCCTTT
TCCACGCTCGAACGCACCATTGCCCACCGCTCTGCCCTCGCCGCCTCGCACTCGCGCATCCAGGCCCTCGCCGAG
GCCCAAGACGCCACTTGGTCGGATCCCTATGCGCGCAACCAGCGCCTGCGCGCCGCCCTGCGTCCTGCTCGTCGC
GAGCGCCTGCGCCAGCGTCTCCGTGACGCGCAAATGGCGCAGCTGGCCCCGGATCTTGTTCTCCTCGACCCGAGC
GAGGAGGATGCGCGGCAGGCTGCGCTTGTCGAATTCGGCGCCAAAAGGGAGCTGAGCGGACATGAAACCGACGTC
GACTGGCAAGATGCTGAACCGAGACTGGCTGCAGACAAGGATGGCGCGTCGATGAATGCTGCCATTTCCCTTTCT
CCAGATGCTCCCCTCGCCAAACCCCTCTTTCACAATACTTCTCGTCACGCCTCTTCTCTTGCCTCGGCCAATCCC
TCTCGCCACGCCTCTTCTCTTGCCTCGGCCATTGCCTCAAAGACTCGCCTTGCCCACGACCCCTTTGTCCAATCT
GCCAGCGCGCACTTTTCCCGACGAAAGAAGCCGCACCGCAAACATGCTCAACCCGAGGCGGCGCCCAAAGCCGGG
TCGTCGTCTCTGCTGGTGCAGTACGACTCTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail