Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6002
Gene name
LocationContig_59:749..2719
Strand+
Gene length (bp)1970
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-33 20 418
PF00083 Sugar_tr Sugar (and other) transporter 4.7E-07 28 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 10 498 3.0E-61
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 10 456 7.0E-49
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 11 456 1.0E-41
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 10 456 4.0E-40
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 25 172 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 10 498 3.0E-61
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 10 456 7.0E-49
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 11 456 1.0E-41
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 10 456 4.0E-40
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 25 172 5.0E-09
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 13 172 4.0E-08
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 13 172 4.0E-08
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 13 172 4.0E-08
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 13 172 4.0E-08
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 13 172 4.0E-08
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 13 172 4.0E-08
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 13 172 7.0E-08
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 17 222 1.0E-07
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 28 162 9.0E-07
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 28 162 9.0E-07
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 25 172 1.0E-06
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 27 233 2.0E-06
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 25 168 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 50 69 19
3 84 106 22
4 140 162 22
5 182 204 22
6 276 293 17
7 331 353 22
8 393 415 22
9 430 452 22
10 459 481 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6002
MVAPSNTPKLPAKQLTILVIARLAEPIALTSVFPYLPEMIRDFGVGQNQVAKWAGITAAIFAISQALTAVSWGRA
ADRVGRKPILLCGLFCTMACFLAWGMSTSLAMAMTVRAIQGLMAIIRTIVAEIVPEKELQPRAFSLMPLVWSLGS
VVGPAFGGALAQPAEKYPSIFSHVDFFKRFPYALPNFVATIFFLISAATIFLFLQETLPAKRHRRDCGLEAGKRL
TRLLFRNPFRHGKNSIEDAEPAPICDRDEGPKTPVAPISPPGVKELCKRPIIISLIAYTFLALHSIAYDQSVTIF
LNYPVIKSTPENTRLPFYFSGGHGLRSSTIGTLFTIYGIVCAIIQFVFYPSLVKRFGIVNCSRACATILPVAYAL
TPFTSLLPTTGTRFVAILCVLIFKSIGSIMSFPCATIILTNSCESIRILSTVNGLATSFSGFARAIGPATTGIIF
SWGAEQGYIISAYLYLVILAVLGAIPAYMTVEGPGPSASSTAETTANDGCVTNDSLHRPCDAATYDCDEDFGSDN
VSSVHSPLLGNAKQKQPASYNAVNH*
Coding >OphauG2|6002
ATGGTCGCACCGTCCAACACGCCCAAGCTGCCCGCCAAGCAATTGACCATATTGGTCATTGCACGGCTTGCTGAG
CCCATCGCCCTCACTTCCGTCTTTCCTTACCTACCCGAGATGATCCGCGACTTTGGCGTCGGCCAAAACCAGGTG
GCAAAATGGGCCGGCATCACCGCTGCCATTTTTGCCATCTCTCAAGCCCTCACTGCTGTGTCATGGGGTCGCGCT
GCAGACCGTGTCGGCCGGAAGCCCATTTTACTCTGCGGTCTCTTTTGCACCATGGCTTGCTTCCTTGCCTGGGGC
ATGTCCACCAGCTTAGCCATGGCCATGACTGTTCGCGCAATTCAGGGCTTGATGGCAATCATCAGAACAATAGTC
GCCGAGATTGTGCCAGAAAAGGAACTACAGCCCCGAGCATTTTCCCTCATGCCTCTCGTCTGGTCCCTGGGCTCT
GTCGTTGGCCCTGCGTTTGGTGGTGCCCTCGCTCAGCCGGCCGAAAAGTATCCAAGTATATTCAGTCACGTCGAC
TTCTTCAAGCGCTTTCCTTATGCTCTCCCCAACTTTGTCGCCACCATCTTCTTTCTAATCTCAGCAGCCACGATT
TTTTTGTTTCTTCAGGAAACACTGCCAGCCAAGCGTCATCGCCGAGACTGTGGACTCGAAGCAGGAAAACGACTC
ACGCGGCTCCTGTTCCGAAACCCGTTCCGTCATGGAAAAAATTCCATCGAAGACGCTGAGCCAGCCCCCATATGT
GACCGGGACGAAGGCCCCAAGACCCCAGTGGCGCCCATTTCACCACCAGGAGTCAAGGAGCTGTGCAAGCGACCC
ATCATCATCAGTCTCATTGCCTACACGTTTCTGGCCCTTCACTCCATTGCATACGACCAAAGCGTCACCATCTTC
CTCAATTATCCCGTCATTAAGTCTACCCCGGAAAATACGCGACTACCATTTTACTTTAGCGGTGGCCATGGACTG
CGGTCGAGCACCATTGGCACTTTATTTACTATTTATGGAATCGTCTGTGCCATTATACAATTCGTCTTCTATCCG
TCACTTGTCAAGCGATTTGGTATTGTCAATTGTTCACGAGCTTGCGCCACCATCCTACCCGTGGCCTACGCCTTG
ACTCCCTTCACATCTCTCTTGCCTACTACCGGCACCCGCTTCGTGGCCATTCTTTGTGTGCTTATTTTCAAAAGC
ATCGGTTCCATCATGTCCTTTCCCTGTGCCACTATAATTCTTACCAACTCTTGCGAATCCATCCGCATTCTTAGT
ACCGTCAATGGTCTCGCAACGTCTTTTAGCGGCTTCGCCCGCGCTATTGGACCCGCAACAACAGGCATCATCTTC
TCTTGGGGTGCCGAACAGGGCTACATCATATCAGCGTATTTGTACCTGGTCATTCTGGCAGTTCTTGGCGCAATA
CCTGCCTATATGACTGTCGAAGGCCCTGGCCCCTCGGCATCCTCGACAGCGGAAACAACCGCCAACGATGGCTGT
GTCACGAACGACTCTCTTCATCGTCCCTGTGATGCGGCTACTTATGATTGCGATGAAGATTTTGGTTCCGATAAT
GTGTCCAGCGTCCATTCTCCTCTCTTGGGCAACGCAAAGCAAAAGCAGCCAGCATCATACAATGCAGTCAACCAC
TAA
Transcript >OphauG2|6002
ATGGTCGCACCGTCCAACACGCCCAAGCTGCCCGCCAAGCAATTGACCATATTGGTCATTGCACGGCTTGCTGAG
CCCATCGCCCTCACTTCCGTCTTTCCTTACCTACCCGAGATGATCCGCGACTTTGGCGTCGGCCAAAACCAGGTG
GCAAAATGGGCCGGCATCACCGCTGCCATTTTTGCCATCTCTCAAGCCCTCACTGCTGTGTCATGGGGTCGCGCT
GCAGACCGTGTCGGCCGGAAGCCCATTTTACTCTGCGGTCTCTTTTGCACCATGGCTTGCTTCCTTGCCTGGGGC
ATGTCCACCAGCTTAGCCATGGCCATGACTGTTCGCGCAATTCAGGGCTTGATGGCAATCATCAGAACAATAGTC
GCCGAGATTGTGCCAGAAAAGGAACTACAGCCCCGAGCATTTTCCCTCATGCCTCTCGTCTGGTCCCTGGGCTCT
GTCGTTGGCCCTGCGTTTGGTGGTGCCCTCGCTCAGCCGGCCGAAAAGTATCCAAGTATATTCAGTCACGTCGAC
TTCTTCAAGCGCTTTCCTTATGCTCTCCCCAACTTTGTCGCCACCATCTTCTTTCTAATCTCAGCAGCCACGATT
TTTTTGTTTCTTCAGGAAACACTGCCAGCCAAGCGTCATCGCCGAGACTGTGGACTCGAAGCAGGAAAACGACTC
ACGCGGCTCCTGTTCCGAAACCCGTTCCGTCATGGAAAAAATTCCATCGAAGACGCTGAGCCAGCCCCCATATGT
GACCGGGACGAAGGCCCCAAGACCCCAGTGGCGCCCATTTCACCACCAGGAGTCAAGGAGCTGTGCAAGCGACCC
ATCATCATCAGTCTCATTGCCTACACGTTTCTGGCCCTTCACTCCATTGCATACGACCAAAGCGTCACCATCTTC
CTCAATTATCCCGTCATTAAGTCTACCCCGGAAAATACGCGACTACCATTTTACTTTAGCGGTGGCCATGGACTG
CGGTCGAGCACCATTGGCACTTTATTTACTATTTATGGAATCGTCTGTGCCATTATACAATTCGTCTTCTATCCG
TCACTTGTCAAGCGATTTGGTATTGTCAATTGTTCACGAGCTTGCGCCACCATCCTACCCGTGGCCTACGCCTTG
ACTCCCTTCACATCTCTCTTGCCTACTACCGGCACCCGCTTCGTGGCCATTCTTTGTGTGCTTATTTTCAAAAGC
ATCGGTTCCATCATGTCCTTTCCCTGTGCCACTATAATTCTTACCAACTCTTGCGAATCCATCCGCATTCTTAGT
ACCGTCAATGGTCTCGCAACGTCTTTTAGCGGCTTCGCCCGCGCTATTGGACCCGCAACAACAGGCATCATCTTC
TCTTGGGGTGCCGAACAGGGCTACATCATATCAGCGTATTTGTACCTGGTCATTCTGGCAGTTCTTGGCGCAATA
CCTGCCTATATGACTGTCGAAGGCCCTGGCCCCTCGGCATCCTCGACAGCGGAAACAACCGCCAACGATGGCTGT
GTCACGAACGACTCTCTTCATCGTCCCTGTGATGCGGCTACTTATGATTGCGATGAAGATTTTGGTTCCGATAAT
GTGTCCAGCGTCCATTCTCCTCTCTTGGGCAACGCAAAGCAAAAGCAGCCAGCATCATACAATGCAGTCAACCAC
TAA
Gene >OphauG2|6002
ATGGTCGCACCGTCCAACACGCCCAAGCTGCCCGCCAAGCAATTGACCATATTGGGTACGTCGAGAAGCAATTCT
TTTCTTGCTGCTTCAAACTCGTCGTGTGCAAAGCGAGTGGTACACTAATAACTACCCTGTACAGTCATTGCACGG
CTTGCTGAGCCCATCGCCCTCACTTCCGTCTTTCCTTACCTACCCGAGATGATCCGCGACTTTGGCGTCGGCCAA
AACCAGGTGGCAAAATGGGCCGGCATCACCGCTGCCATTTTTGCCATCTCTCAAGCCCTCACTGCTGTGTCATGG
GGTCGCGCTGCAGACCGTGTCGGCCGGAAGCCCATTTTACTCTGCGGTCTCTTTTGCACCATGGCTTGCTTCCTT
GCCTGGGGCATGTCCACCAGCTTAGCCATGGCCATGACTGTTCGCGCAATTCAGGGCTTGAGTAATGGGAATGGC
AAGTTGCTTCCTCGATCCCTCTCTTTAACCCTTGACCTTGCTGCGACAAGACTCCATGCAAACTGCTGACCCTTC
TCCAGTGGCAATCATCAGAACAATAGTCGCCGAGATTGTGCCAGAAAAGGAACTACAGCCCCGAGCATTTTCCCT
CATGCCTCTCGTCTGGTCCCTGGGCTCTGTCGTTGGCCCTGCGTTTGGTGGTGCCCTCGCTCAGCCGGCCGAAAA
GTATCCAAGTATATTCAGTCACGTCGACTTCTTCAAGCGCTTTCCTTATGCTCTCCCCAACTTTGTCGCCACCAT
CTTCTTTCTAATCTCAGCAGCCACGATTTTTTTGTTTCTTCAGGTACCTTTTCATCGCCTCATCTCAAACTCTGT
TTATTGTGATAATTCGCTGATGTGTAAATATTTATCATCCAGGAAACACTGCCAGCCAAGCGTCATCGCCGAGAC
TGTGGACTCGAAGCAGGAAAACGACTCACGCGGCTCCTGTTCCGAAACCCGTTCCGTCATGGAAAAAATTCCATC
GAAGACGCTGAGCCAGCCCCCATATGTGACCGGGACGAAGGCCCCAAGACCCCAGTGGCGCCCATTTCACCACCA
GGAGTCAAGGAGCTGTGCAAGCGACCCATCATCATCAGTCTCATTGCCTACACGTTTCTGGCCCTTCACTCCATT
GCATACGACCAAAGCGTCACCATCTTCCTCAATTATCCCGTCATTAAGTCTACCCCGGAAAATACGCGACTACCA
TTTTACTTTAGCGGTGGCCATGGACTGCGGTCGAGCACCATTGGCACTTTATTTACTATTTATGGAATCGTCTGT
GCCATTATACAATTCGTCTTCTATCCGTCACTTGTCAAGCGATTTGGTATTGTCAATTGTTCACGAGCTTGCGGT
GAGTCTATTCTTGCTCAGGGCACGCTTCTCTCGCAAGCAATATGTGGCTGATATTAGTCAAAGCCACCATCCTAC
CCGTGGCCTACGCCTTGACTCCCTTCACATCTCTCTTGCCTACTACCGGCACCCGCTTCGTGGCCATTCTTTGTG
TGCTTATTTTCAAAAGCATCGGTTCCATCATGTCCTTTCCCTGTGCCACTATAATTCTTACCAACTCTTGCGAAT
CCATCCGCATTCTTAGTACCGTCAATGGTCTCGCAACGTCTTTTAGCGGCTTCGCCCGCGCTATTGGACCCGCAA
CAACAGGCATCATCTTCTCTTGGGGTGCCGAACAGGGCTACATCATATCAGCGTATTTGTACCTGGTCATTCTGG
CAGTTCTTGGCGCAATACCTGCCTATATGACTGTCGAAGGCCCTGGCCCCTCGGCATCCTCGACAGCGGAAACAA
CCGCCAACGATGGCTGTGTCACGAACGACTCTCTTCATCGTCCCTGTGATGCGGCTACTTATGATTGCGATGAAG
ATTTTGGTTCCGATAATGTGTCCAGCGTCCATTCTCCTCTCTTGGGCAACGCAAAGCAAAAGCAGCCAGCATCAT
ACAATGCAGTCAACCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail