Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5989
Gene name
LocationContig_585:7255..8140
Strand-
Gene length (bp)885
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 9.2E-35 28 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAW9|FTMF_ASPFU Verruculogen synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmOx1 PE=1 SV=1 4 271 7.0E-43
sp|B9WZX5|FTMF_ASPFM Verruculogen synthase OS=Neosartorya fumigata GN=ftmOx1 PE=3 SV=1 4 271 1.0E-42
sp|A1DA64|FTMF_NEOFI Verruculogen synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmOx1 PE=3 SV=1 4 271 1.0E-40
sp|P67773|Y3657_MYCBO Uncharacterized protein Mb3657 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3657 PE=3 SV=1 105 264 1.0E-12
sp|P9WI89|Y3633_MYCTU Uncharacterized protein Rv3633 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3633 PE=1 SV=1 105 264 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAW9|FTMF_ASPFU Verruculogen synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmOx1 PE=1 SV=1 4 271 7.0E-43
sp|B9WZX5|FTMF_ASPFM Verruculogen synthase OS=Neosartorya fumigata GN=ftmOx1 PE=3 SV=1 4 271 1.0E-42
sp|A1DA64|FTMF_NEOFI Verruculogen synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmOx1 PE=3 SV=1 4 271 1.0E-40
sp|P67773|Y3657_MYCBO Uncharacterized protein Mb3657 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3657 PE=3 SV=1 105 264 1.0E-12
sp|P9WI89|Y3633_MYCTU Uncharacterized protein Rv3633 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3633 PE=1 SV=1 105 264 1.0E-12
sp|P9WI88|Y3633_MYCTO Uncharacterized protein MT3735 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3735 PE=3 SV=1 105 264 1.0E-12
sp|P47181|YJ9S_YEAST Uncharacterized protein YJR154W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR154W PE=1 SV=1 20 290 2.0E-12
sp|O62515|PAHX_CAEEL Probable phytanoyl-CoA dioxygenase OS=Caenorhabditis elegans GN=ZK550.6 PE=3 SV=2 124 277 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5989
MSATASSAARAQQVKATQGHEAILKALRDDGAVIIKGLVKADDMHAIDDEIRPALEKHREGTELSEEWFKEFHGV
YTRRLMNMVTLSKTFRQSVLENDLMHKLCEEVFLKDSGTYWMNSAQVIDIGPGSRAQPLHRDQWQFPIFTLCGRD
APEASINFIFALNKVTEENGATRVILGSHKWSDFKEHGTSEDTIPLEMDPGDAVFISGKVVHGGGANTTTDVRRR
AISMVVQCSYLTPEEAYPFLVEQELAETLSPRAQRMIGFRSQFPLDSPGVWKCDYSDKGEIVHGSKSFA*
Coding >OphauG2|5989
ATGTCTGCCACCGCAAGCTCAGCTGCCAGGGCGCAGCAAGTCAAAGCCACCCAAGGCCATGAAGCCATCCTTAAA
GCCCTCCGTGACGATGGAGCAGTCATCATCAAGGGCCTCGTAAAGGCAGACGATATGCACGCTATTGACGACGAA
ATCAGACCAGCCTTGGAAAAACACAGAGAGGGCACCGAGCTATCAGAAGAATGGTTCAAGGAGTTCCATGGCGTT
TACACCAGGCGTCTTATGAATATGGTTACTCTTAGCAAGACCTTTCGCCAGTCAGTTTTAGAGAACGATTTGATG
CATAAACTATGCGAAGAAGTCTTCCTCAAGGACTCGGGCACATATTGGATGAACTCGGCTCAAGTCATCGACATT
GGCCCGGGAAGCAGGGCTCAACCGCTGCACCGTGACCAGTGGCAGTTCCCCATCTTTACTCTCTGTGGTCGTGAT
GCCCCCGAGGCCTCCATCAACTTCATCTTCGCCTTGAACAAGGTTACTGAAGAAAACGGCGCCACCCGAGTCATC
CTCGGGAGCCACAAATGGAGTGACTTTAAAGAACATGGCACATCCGAGGACACCATTCCGCTTGAAATGGACCCA
GGCGACGCAGTCTTCATCAGCGGCAAGGTGGTGCACGGCGGTGGAGCCAACACGACTACAGACGTTAGGAGGAGG
GCTATATCCATGGTCGTTCAATGCTCATACTTGACTCCCGAAGAAGCATACCCATTCCTCGTGGAACAAGAGCTC
GCTGAAACATTGAGCCCGCGAGCGCAGCGCATGATTGGCTTTCGCTCGCAGTTTCCCTTGGACAGCCCTGGCGTG
TGGAAATGCGATTACAGCGATAAAGGTGAAATTGTGCATGGCTCAAAGTCCTTTGCGTAG
Transcript >OphauG2|5989
ATGTCTGCCACCGCAAGCTCAGCTGCCAGGGCGCAGCAAGTCAAAGCCACCCAAGGCCATGAAGCCATCCTTAAA
GCCCTCCGTGACGATGGAGCAGTCATCATCAAGGGCCTCGTAAAGGCAGACGATATGCACGCTATTGACGACGAA
ATCAGACCAGCCTTGGAAAAACACAGAGAGGGCACCGAGCTATCAGAAGAATGGTTCAAGGAGTTCCATGGCGTT
TACACCAGGCGTCTTATGAATATGGTTACTCTTAGCAAGACCTTTCGCCAGTCAGTTTTAGAGAACGATTTGATG
CATAAACTATGCGAAGAAGTCTTCCTCAAGGACTCGGGCACATATTGGATGAACTCGGCTCAAGTCATCGACATT
GGCCCGGGAAGCAGGGCTCAACCGCTGCACCGTGACCAGTGGCAGTTCCCCATCTTTACTCTCTGTGGTCGTGAT
GCCCCCGAGGCCTCCATCAACTTCATCTTCGCCTTGAACAAGGTTACTGAAGAAAACGGCGCCACCCGAGTCATC
CTCGGGAGCCACAAATGGAGTGACTTTAAAGAACATGGCACATCCGAGGACACCATTCCGCTTGAAATGGACCCA
GGCGACGCAGTCTTCATCAGCGGCAAGGTGGTGCACGGCGGTGGAGCCAACACGACTACAGACGTTAGGAGGAGG
GCTATATCCATGGTCGTTCAATGCTCATACTTGACTCCCGAAGAAGCATACCCATTCCTCGTGGAACAAGAGCTC
GCTGAAACATTGAGCCCGCGAGCGCAGCGCATGATTGGCTTTCGCTCGCAGTTTCCCTTGGACAGCCCTGGCGTG
TGGAAATGCGATTACAGCGATAAAGGTGAAATTGTGCATGGCTCAAAGTCCTTTGCGTAG
Gene >OphauG2|5989
ATGTCTGCCACCGCAAGCTCAGCTGCCAGGGCGCAGCAAGTCAAAGCCACCCAAGGCCATGAAGCCATCCTTAAA
GCCCTCCGTGACGATGGAGCAGTCATCATCAAGGGCCTCGTAAAGGCAGACGATATGCACGCTATTGACGACGAA
ATCAGACCAGCCTTGGAAAAACACAGAGAGGGCACCGAGCTATCAGAAGAATGGTTCAAGGAGTTCCATGGCGTT
TACACCAGGCGTCTTATGAATATGGTTACTCTTAGCAAGACCTTTCGCCAGTCAGTTTTAGAGAACGATTTGATG
CATAAACTATGCGAAGAAGTCTTCCTCAAGGACTCGGGCACATATTGGATGAACTCGGCTCAAGTCATCGACATT
GGCCCGGGAAGCAGGGCTCAACCGCTGCACCGTGACCAGTGGCAGTTCCCCATCTTTACTCTCTGTGGTCGTGAT
GCCCCCGAGGCCTCCATCAACTTCATCTTCGCCTTGAACAAGGTTACTGAAGAAAACGGCGCCACCCGAGTCATC
CTCGGGAGCCACAAATGGAGTGACTTTAAAGAACATGGCACATCCGAGGACACCATTCCGCTTGAAATGGACCCA
GGCGACGCAGTCTTCATCAGCGGCAAGGTGGTGCACGGCGGTGGAGCCAACACGACTACAGACGTTAGGAGGAGG
GCTATATCCATGGTCGTTCAATGCTCATACTTGACTCCCGAAGAAGCATACCCATTCCTCGTGGAACAAGAGCTC
GCTGAAACATTGAGCCCGCGAGCGCAGCGCATGATTGGCTTTCGCTCGCAGTTTCCCTTGGACAGCCCTGGCGTG
TGGAAATGCGATTACAGCGATAAAGGTGAAATTGTGCATGGCTCAAAGTCCTTTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail