Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5988
Gene name
LocationContig_585:4559..6197
Strand-
Gene length (bp)1638
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 8.1E-36 21 205
PF00958 GMP_synt_C GMP synthase C terminal domain 1.2E-34 454 544
PF02540 NAD_synthase NAD synthase 1.3E-06 219 297
PF07722 Peptidase_C26 Peptidase C26 5.3E-08 84 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UFN0|GUAA_ASPOR GMP synthase [glutamine-hydrolyzing] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gua1 PE=3 SV=1 11 545 0.0E+00
sp|Q4WFT3|GUAA_ASPFU GMP synthase [glutamine-hydrolyzing] OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gua1 PE=3 SV=1 7 545 0.0E+00
sp|Q5B1L4|GUAA_EMENI GMP synthase [glutamine-hydrolyzing] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gua1 PE=3 SV=1 11 545 0.0E+00
sp|Q4HXF0|GUAA_GIBZE GMP synthase [glutamine-hydrolyzing] OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GUA1 PE=3 SV=2 1 545 0.0E+00
sp|Q0UHC4|GUAA_PHANO GMP synthase [glutamine-hydrolyzing] OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUA1 PE=3 SV=1 11 545 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UFN0|GUAA_ASPOR GMP synthase [glutamine-hydrolyzing] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gua1 PE=3 SV=1 11 545 0.0E+00
sp|Q4WFT3|GUAA_ASPFU GMP synthase [glutamine-hydrolyzing] OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gua1 PE=3 SV=1 7 545 0.0E+00
sp|Q5B1L4|GUAA_EMENI GMP synthase [glutamine-hydrolyzing] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gua1 PE=3 SV=1 11 545 0.0E+00
sp|Q4HXF0|GUAA_GIBZE GMP synthase [glutamine-hydrolyzing] OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GUA1 PE=3 SV=2 1 545 0.0E+00
sp|Q0UHC4|GUAA_PHANO GMP synthase [glutamine-hydrolyzing] OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUA1 PE=3 SV=1 11 545 0.0E+00
sp|P38625|GUAA_YEAST GMP synthase [glutamine-hydrolyzing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUA1 PE=1 SV=4 15 545 0.0E+00
sp|Q6CEF3|GUAA_YARLI GMP synthase [glutamine-hydrolyzing] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GUA1 PE=3 SV=1 15 545 0.0E+00
sp|Q756B7|GUAA_ASHGO GMP synthase [glutamine-hydrolyzing] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUA1 PE=3 SV=1 3 545 0.0E+00
sp|Q6FUF3|GUAA_CANGA GMP synthase [glutamine-hydrolyzing] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUA1 PE=3 SV=1 9 545 0.0E+00
sp|Q5APF2|GUAA_CANAL GMP synthase [glutamine-hydrolyzing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUA1 PE=3 SV=1 1 545 0.0E+00
sp|Q6CU71|GUAA_KLULA GMP synthase [glutamine-hydrolyzing] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GUA1 PE=3 SV=1 15 545 0.0E+00
sp|Q6BLS3|GUAA_DEBHA GMP synthase [glutamine-hydrolyzing] OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GUA1 PE=3 SV=1 5 545 0.0E+00
sp|Q9P772|GUAA_SCHPO GMP synthase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gua1 PE=3 SV=1 15 545 0.0E+00
sp|Q4P763|GUAA_USTMA GMP synthase [glutamine-hydrolyzing] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GUA1 PE=3 SV=1 9 543 0.0E+00
sp|Q8KFZ5|GUAA_CHLTE GMP synthase [glutamine-hydrolyzing] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=guaA PE=3 SV=1 14 545 3.0E-179
sp|O66601|GUAA_AQUAE GMP synthase [glutamine-hydrolyzing] OS=Aquifex aeolicus (strain VF5) GN=guaA PE=3 SV=1 18 545 5.0E-179
sp|Q6G5J3|GUAA_BARHE GMP synthase [glutamine-hydrolyzing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=guaA PE=3 SV=1 16 545 1.0E-178
sp|Q3B1J3|GUAA_CHLL7 GMP synthase [glutamine-hydrolyzing] OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=guaA PE=3 SV=1 17 545 7.0E-178
sp|A9WY54|GUAA_BRUSI GMP synthase [glutamine-hydrolyzing] OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=guaA PE=3 SV=1 16 545 9.0E-178
sp|Q577H0|GUAA_BRUAB GMP synthase [glutamine-hydrolyzing] OS=Brucella abortus biovar 1 (strain 9-941) GN=guaA PE=3 SV=1 16 545 9.0E-178
sp|Q2YK38|GUAA_BRUA2 GMP synthase [glutamine-hydrolyzing] OS=Brucella abortus (strain 2308) GN=guaA PE=3 SV=1 16 545 9.0E-178
sp|B2SBN5|GUAA_BRUA1 GMP synthase [glutamine-hydrolyzing] OS=Brucella abortus (strain S19) GN=guaA PE=3 SV=1 16 545 9.0E-178
sp|C0RKS9|GUAA_BRUMB GMP synthase [glutamine-hydrolyzing] OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=guaA PE=3 SV=1 16 545 1.0E-177
sp|Q8FWT4|GUAA_BRUSU GMP synthase [glutamine-hydrolyzing] OS=Brucella suis biovar 1 (strain 1330) GN=guaA PE=3 SV=1 16 545 7.0E-177
sp|A9MEB0|GUAA_BRUC2 GMP synthase [glutamine-hydrolyzing] OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=guaA PE=3 SV=1 16 545 7.0E-177
sp|A5VU71|GUAA_BRUO2 GMP synthase [glutamine-hydrolyzing] OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=guaA PE=3 SV=1 16 545 7.0E-177
sp|A6Q4N8|GUAA_NITSB GMP synthase [glutamine-hydrolyzing] OS=Nitratiruptor sp. (strain SB155-2) GN=guaA PE=3 SV=1 18 545 9.0E-177
sp|Q2S0V0|GUAA_SALRD GMP synthase [glutamine-hydrolyzing] OS=Salinibacter ruber (strain DSM 13855 / M31) GN=guaA PE=3 SV=1 15 545 1.0E-176
sp|A4SGJ0|GUAA_CHLPM GMP synthase [glutamine-hydrolyzing] OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=guaA PE=3 SV=1 17 545 7.0E-176
sp|Q2RXI5|GUAA_RHORT GMP synthase [glutamine-hydrolyzing] OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=guaA PE=3 SV=1 13 545 8.0E-176
sp|Q1QKC3|GUAA_NITHX GMP synthase [glutamine-hydrolyzing] OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=guaA PE=3 SV=1 4 545 4.0E-175
sp|B4SFX7|GUAA_PELPB GMP synthase [glutamine-hydrolyzing] OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=guaA PE=3 SV=1 17 545 4.0E-175
sp|Q3AT13|GUAA_CHLCH GMP synthase [glutamine-hydrolyzing] OS=Chlorobium chlorochromatii (strain CaD3) GN=guaA PE=3 SV=1 17 545 1.0E-174
sp|B3QYF4|GUAA_CHLT3 GMP synthase [glutamine-hydrolyzing] OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=guaA PE=3 SV=1 16 545 6.0E-174
sp|C0QYF1|GUAA_BRAHW GMP synthase [glutamine-hydrolyzing] OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=guaA PE=3 SV=1 16 545 1.0E-173
sp|B3EEV3|GUAA_CHLL2 GMP synthase [glutamine-hydrolyzing] OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=guaA PE=3 SV=1 17 545 2.0E-173
sp|B3ELI1|GUAA_CHLPB GMP synthase [glutamine-hydrolyzing] OS=Chlorobium phaeobacteroides (strain BS1) GN=guaA PE=3 SV=1 17 545 2.0E-173
sp|Q7M8K2|GUAA_WOLSU GMP synthase [glutamine-hydrolyzing] OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=guaA PE=3 SV=1 17 545 4.0E-173
sp|Q3SQP4|GUAA_NITWN GMP synthase [glutamine-hydrolyzing] OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=guaA PE=3 SV=1 13 545 7.0E-173
sp|Q6G197|GUAA_BARQU GMP synthase [glutamine-hydrolyzing] OS=Bartonella quintana (strain Toulouse) GN=guaA PE=3 SV=1 16 545 1.0E-172
sp|A1URR0|GUAA_BARBK GMP synthase [glutamine-hydrolyzing] OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=guaA PE=3 SV=1 16 545 4.0E-172
sp|B9J7L1|GUAA_AGRRK GMP synthase [glutamine-hydrolyzing] OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=guaA PE=3 SV=1 16 545 1.0E-171
sp|B4R9R7|GUAA_PHEZH GMP synthase [glutamine-hydrolyzing] OS=Phenylobacterium zucineum (strain HLK1) GN=guaA PE=3 SV=1 15 545 2.0E-171
sp|B6JHM4|GUAA_OLICO GMP synthase [glutamine-hydrolyzing] OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=guaA PE=3 SV=1 14 545 3.0E-171
sp|Q92SQ3|GUAA_RHIME GMP synthase [glutamine-hydrolyzing] OS=Rhizobium meliloti (strain 1021) GN=guaA PE=3 SV=1 16 545 3.0E-171
sp|C3MCS5|GUAA_RHISN GMP synthase [glutamine-hydrolyzing] OS=Rhizobium sp. (strain NGR234) GN=guaA PE=3 SV=1 16 545 5.0E-171
sp|Q8RDR4|GUAA_FUSNN GMP synthase [glutamine-hydrolyzing] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=guaA PE=3 SV=1 18 545 5.0E-171
sp|C1A3W7|GUAA_GEMAT GMP synthase [glutamine-hydrolyzing] OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=guaA PE=3 SV=1 18 545 1.0E-170
sp|Q1MMJ7|GUAA_RHIL3 GMP synthase [glutamine-hydrolyzing] OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=guaA PE=3 SV=1 16 545 1.0E-170
sp|B5ZYE9|GUAA_RHILW GMP synthase [glutamine-hydrolyzing] OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=guaA PE=3 SV=1 16 545 1.0E-170
sp|Q2KDG7|GUAA_RHIEC GMP synthase [glutamine-hydrolyzing] OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=guaA PE=3 SV=1 16 545 2.0E-170
sp|Q311X7|GUAA_DESAG GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio alaskensis (strain G20) GN=guaA PE=3 SV=1 16 545 2.0E-170
sp|B1KLC1|GUAA_SHEWM GMP synthase [glutamine-hydrolyzing] OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=guaA PE=3 SV=1 18 545 2.0E-170
sp|Q2RGP2|GUAA_MOOTA GMP synthase [glutamine-hydrolyzing] OS=Moorella thermoacetica (strain ATCC 39073) GN=guaA PE=3 SV=1 13 545 3.0E-170
sp|B3PYH7|GUAA_RHIE6 GMP synthase [glutamine-hydrolyzing] OS=Rhizobium etli (strain CIAT 652) GN=guaA PE=3 SV=1 12 545 4.0E-170
sp|P60500|GUAA_GEOSL GMP synthase [glutamine-hydrolyzing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=guaA PE=3 SV=1 16 545 6.0E-170
sp|A6LKY1|GUAA_THEM4 GMP synthase [glutamine-hydrolyzing] OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=guaA PE=3 SV=1 17 545 1.0E-169
sp|P60501|GUAA_RHOPA GMP synthase [glutamine-hydrolyzing] OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=guaA PE=3 SV=1 10 545 2.0E-169
sp|B7IHI2|GUAA_THEAB GMP synthase [glutamine-hydrolyzing] OS=Thermosipho africanus (strain TCF52B) GN=guaA PE=3 SV=1 16 545 3.0E-169
sp|Q89N53|GUAA_BRADU GMP synthase [glutamine-hydrolyzing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=guaA PE=3 SV=1 13 545 3.0E-169
sp|C4XSN8|GUAA_DESMR GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=guaA PE=3 SV=1 16 545 5.0E-169
sp|Q30TH8|GUAA_SULDN GMP synthase [glutamine-hydrolyzing] OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=guaA PE=3 SV=1 17 545 6.0E-169
sp|A7I131|GUAA_CAMHC GMP synthase [glutamine-hydrolyzing] OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=guaA PE=3 SV=1 18 545 9.0E-169
sp|Q212S9|GUAA_RHOPB GMP synthase [glutamine-hydrolyzing] OS=Rhodopseudomonas palustris (strain BisB18) GN=guaA PE=3 SV=1 10 545 1.0E-168
sp|C6BSD8|GUAA_DESAD GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=guaA PE=3 SV=1 13 545 1.0E-168
sp|O25165|GUAA_HELPY GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaA PE=3 SV=1 18 545 1.0E-168
sp|Q5FPL0|GUAA_GLUOX GMP synthase [glutamine-hydrolyzing] OS=Gluconobacter oxydans (strain 621H) GN=guaA PE=3 SV=1 16 545 2.0E-168
sp|Q7NSG1|GUAA_CHRVO GMP synthase [glutamine-hydrolyzing] OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=guaA PE=3 SV=1 16 545 2.0E-168
sp|A1BD85|GUAA_CHLPD GMP synthase [glutamine-hydrolyzing] OS=Chlorobium phaeobacteroides (strain DSM 266) GN=guaA PE=3 SV=1 17 545 2.0E-168
sp|A6UFA3|GUAA_SINMW GMP synthase [glutamine-hydrolyzing] OS=Sinorhizobium medicae (strain WSM419) GN=guaA PE=3 SV=1 16 545 3.0E-168
sp|A4YSU1|GUAA_BRASO GMP synthase [glutamine-hydrolyzing] OS=Bradyrhizobium sp. (strain ORS278) GN=guaA PE=3 SV=1 15 545 5.0E-168
sp|Q5NN19|GUAA_ZYMMO GMP synthase [glutamine-hydrolyzing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=guaA PE=3 SV=1 16 545 5.0E-168
sp|Q60C21|GUAA_METCA GMP synthase [glutamine-hydrolyzing] OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=guaA PE=3 SV=1 18 545 5.0E-168
sp|A1AQJ8|GUAA_PELPD GMP synthase [glutamine-hydrolyzing] OS=Pelobacter propionicus (strain DSM 2379) GN=guaA PE=3 SV=1 18 545 7.0E-168
sp|B8CKS4|GUAA_SHEPW GMP synthase [glutamine-hydrolyzing] OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=guaA PE=3 SV=1 18 545 8.0E-168
sp|Q9ZKG4|GUAA_HELPJ GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaA PE=3 SV=1 18 545 1.0E-167
sp|Q1CSM2|GUAA_HELPH GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain HPAG1) GN=guaA PE=3 SV=1 18 545 2.0E-167
sp|A8ETA7|GUAA_ARCB4 GMP synthase [glutamine-hydrolyzing] OS=Arcobacter butzleri (strain RM4018) GN=guaA PE=3 SV=1 18 545 3.0E-167
sp|A3QCH0|GUAA_SHELP GMP synthase [glutamine-hydrolyzing] OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=guaA PE=3 SV=1 18 545 3.0E-167
sp|Q4ZX09|GUAA_PSEU2 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas syringae pv. syringae (strain B728a) GN=guaA PE=3 SV=1 18 545 4.0E-167
sp|Q0ADW4|GUAA_NITEC GMP synthase [glutamine-hydrolyzing] OS=Nitrosomonas eutropha (strain C91) GN=guaA PE=3 SV=1 15 545 4.0E-167
sp|Q886X5|GUAA_PSESM GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=guaA PE=3 SV=1 18 545 5.0E-167
sp|Q82XZ6|GUAA_NITEU GMP synthase [glutamine-hydrolyzing] OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=guaA PE=3 SV=1 15 545 8.0E-167
sp|B9JZA3|GUAA_AGRVS GMP synthase [glutamine-hydrolyzing] OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=guaA PE=3 SV=1 16 545 1.0E-166
sp|Q13XE2|GUAA_BURXL GMP synthase [glutamine-hydrolyzing] OS=Burkholderia xenovorans (strain LB400) GN=guaA PE=3 SV=1 15 545 1.0E-166
sp|Q48LY0|GUAA_PSE14 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=guaA PE=3 SV=1 18 545 1.0E-166
sp|B6JMN5|GUAA_HELP2 GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain P12) GN=guaA PE=3 SV=1 18 545 1.0E-166
sp|Q6APU2|GUAA_DESPS GMP synthase [glutamine-hydrolyzing] OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=guaA PE=3 SV=1 16 545 2.0E-166
sp|A1S856|GUAA_SHEAM GMP synthase [glutamine-hydrolyzing] OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=guaA PE=3 SV=1 18 545 2.0E-166
sp|Q3AD70|GUAA_CARHZ GMP synthase [glutamine-hydrolyzing] OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=guaA PE=3 SV=1 18 545 2.0E-166
sp|B2UUF1|GUAA_HELPS GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain Shi470) GN=guaA PE=3 SV=1 18 545 2.0E-166
sp|Q3A590|GUAA_PELCD GMP synthase [glutamine-hydrolyzing] OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=guaA PE=3 SV=1 16 545 3.0E-166
sp|B9M9G4|GUAA_GEODF GMP synthase [glutamine-hydrolyzing] OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=guaA PE=3 SV=1 16 545 3.0E-166
sp|P60502|GUAA_SPIKU GMP synthase [glutamine-hydrolyzing] OS=Spiroplasma kunkelii GN=guaA PE=3 SV=1 16 545 3.0E-166
sp|Q7UFS3|GUAA_RHOBA GMP synthase [glutamine-hydrolyzing] OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=guaA PE=3 SV=1 18 545 3.0E-166
sp|B2JIA0|GUAA_BURP8 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=guaA PE=3 SV=1 15 545 4.0E-166
sp|Q3JDG3|GUAA_NITOC GMP synthase [glutamine-hydrolyzing] OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=guaA PE=3 SV=1 18 545 4.0E-166
sp|B5Z842|GUAA_HELPG GMP synthase [glutamine-hydrolyzing] OS=Helicobacter pylori (strain G27) GN=guaA PE=3 SV=1 18 545 5.0E-166
sp|Q085S4|GUAA_SHEFN GMP synthase [glutamine-hydrolyzing] OS=Shewanella frigidimarina (strain NCIMB 400) GN=guaA PE=3 SV=1 18 545 6.0E-166
sp|A8H254|GUAA_SHEPA GMP synthase [glutamine-hydrolyzing] OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=guaA PE=3 SV=1 18 545 6.0E-166
sp|Q5E763|GUAA_VIBF1 GMP synthase [glutamine-hydrolyzing] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=guaA PE=3 SV=1 18 545 6.0E-166
sp|Q17YH9|GUAA_HELAH GMP synthase [glutamine-hydrolyzing] OS=Helicobacter acinonychis (strain Sheeba) GN=guaA PE=3 SV=1 18 545 6.0E-166
sp|A7MU26|GUAA_VIBCB GMP synthase [glutamine-hydrolyzing] OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=guaA PE=3 SV=1 18 545 6.0E-166
sp|B3PIG3|GUAA_CELJU GMP synthase [glutamine-hydrolyzing] OS=Cellvibrio japonicus (strain Ueda107) GN=guaA PE=3 SV=1 18 545 1.0E-165
sp|Q0VNF0|GUAA_ALCBS GMP synthase [glutamine-hydrolyzing] OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=guaA PE=3 SV=1 18 545 1.0E-165
sp|Q39TA7|GUAA_GEOMG GMP synthase [glutamine-hydrolyzing] OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=guaA PE=3 SV=1 16 545 2.0E-165
sp|Q2IV75|GUAA_RHOP2 GMP synthase [glutamine-hydrolyzing] OS=Rhodopseudomonas palustris (strain HaA2) GN=guaA PE=3 SV=1 10 545 2.0E-165
sp|B6EGZ6|GUAA_ALISL GMP synthase [glutamine-hydrolyzing] OS=Aliivibrio salmonicida (strain LFI1238) GN=guaA PE=3 SV=1 18 545 2.0E-165
sp|B8E9T4|GUAA_SHEB2 GMP synthase [glutamine-hydrolyzing] OS=Shewanella baltica (strain OS223) GN=guaA PE=3 SV=1 18 545 3.0E-165
sp|Q8DF07|GUAA_VIBVU GMP synthase [glutamine-hydrolyzing] OS=Vibrio vulnificus (strain CMCP6) GN=guaA PE=3 SV=1 18 545 3.0E-165
sp|B9KFL4|GUAA_CAMLR GMP synthase [glutamine-hydrolyzing] OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=guaA PE=3 SV=1 18 545 3.0E-165
sp|Q2SCJ3|GUAA_HAHCH GMP synthase [glutamine-hydrolyzing] OS=Hahella chejuensis (strain KCTC 2396) GN=guaA PE=3 SV=1 18 545 3.0E-165
sp|Q4K6W4|GUAA_PSEF5 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|B5FAY1|GUAA_VIBFM GMP synthase [glutamine-hydrolyzing] OS=Vibrio fischeri (strain MJ11) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|A9KWW6|GUAA_SHEB9 GMP synthase [glutamine-hydrolyzing] OS=Shewanella baltica (strain OS195) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|A6WQP0|GUAA_SHEB8 GMP synthase [glutamine-hydrolyzing] OS=Shewanella baltica (strain OS185) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|A3D6V2|GUAA_SHEB5 GMP synthase [glutamine-hydrolyzing] OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|Q7MNE1|GUAA_VIBVY GMP synthase [glutamine-hydrolyzing] OS=Vibrio vulnificus (strain YJ016) GN=guaA PE=3 SV=1 18 545 4.0E-165
sp|B2T5G8|GUAA_BURPP GMP synthase [glutamine-hydrolyzing] OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=guaA PE=3 SV=1 15 545 5.0E-165
sp|A1VEV0|GUAA_DESVV GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=guaA PE=3 SV=1 14 545 5.0E-165
sp|Q72D86|GUAA_DESVH GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=guaA PE=3 SV=1 14 545 5.0E-165
sp|B0TI09|GUAA_HELMI GMP synthase [glutamine-hydrolyzing] OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=guaA PE=3 SV=1 13 545 5.0E-165
sp|B8D0Z5|GUAA_HALOH GMP synthase [glutamine-hydrolyzing] OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=guaA PE=3 SV=1 16 545 5.0E-165
sp|Q88P21|GUAA_PSEPK GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas putida (strain KT2440) GN=guaA PE=3 SV=1 18 545 6.0E-165
sp|C5BER5|GUAA_EDWI9 GMP synthase [glutamine-hydrolyzing] OS=Edwardsiella ictaluri (strain 93-146) GN=guaA PE=3 SV=1 12 545 6.0E-165
sp|Q8UIL2|GUAA_AGRFC GMP synthase [glutamine-hydrolyzing] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=guaA PE=3 SV=1 16 545 7.0E-165
sp|Q6LU31|GUAA_PHOPR GMP synthase [glutamine-hydrolyzing] OS=Photobacterium profundum GN=guaA PE=3 SV=1 18 545 8.0E-165
sp|A1RHR0|GUAA_SHESW GMP synthase [glutamine-hydrolyzing] OS=Shewanella sp. (strain W3-18-1) GN=guaA PE=3 SV=1 18 545 8.0E-165
sp|A4Y8T3|GUAA_SHEPC GMP synthase [glutamine-hydrolyzing] OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=guaA PE=3 SV=1 18 545 8.0E-165
sp|Q67S57|GUAA_SYMTH GMP synthase [glutamine-hydrolyzing] OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=guaA PE=3 SV=1 13 545 1.0E-164
sp|A5VZC3|GUAA_PSEP1 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=guaA PE=3 SV=1 18 545 1.0E-164
sp|B1JDH6|GUAA_PSEPW GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas putida (strain W619) GN=guaA PE=3 SV=1 18 545 1.0E-164
sp|Q987R3|GUAA_RHILO GMP synthase [glutamine-hydrolyzing] OS=Rhizobium loti (strain MAFF303099) GN=guaA PE=3 SV=1 16 545 1.0E-164
sp|Q1H280|GUAA_METFK GMP synthase [glutamine-hydrolyzing] OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=guaA PE=3 SV=1 18 545 1.0E-164
sp|B0KRE6|GUAA_PSEPG GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas putida (strain GB-1) GN=guaA PE=3 SV=1 18 545 1.0E-164
sp|A8FY04|GUAA_SHESH GMP synthase [glutamine-hydrolyzing] OS=Shewanella sediminis (strain HAW-EB3) GN=guaA PE=3 SV=1 18 545 1.0E-164
sp|Q8RC63|GUAA_CALS4 GMP synthase [glutamine-hydrolyzing] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=guaA PE=3 SV=1 16 545 1.0E-164
sp|A4IXW6|GUAA_FRATW GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|B8DNB9|GUAA_DESVM GMP synthase [glutamine-hydrolyzing] OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=guaA PE=3 SV=1 13 545 2.0E-164
sp|Q2NS52|GUAA_SODGM GMP synthase [glutamine-hydrolyzing] OS=Sodalis glossinidius (strain morsitans) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|A1K5U3|GUAA_AZOSB GMP synthase [glutamine-hydrolyzing] OS=Azoarcus sp. (strain BH72) GN=guaA PE=3 SV=1 14 545 2.0E-164
sp|Q12PS0|GUAA_SHEDO GMP synthase [glutamine-hydrolyzing] OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|B6J7Z4|GUAA_COXB1 GMP synthase [glutamine-hydrolyzing] OS=Coxiella burnetii (strain CbuK_Q154) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|Q2A3D4|GUAA_FRATH GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. holarctica (strain LVS) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|B0U0B2|GUAA_FRAP2 GMP synthase [glutamine-hydrolyzing] OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|Q3K7D0|GUAA_PSEPF GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas fluorescens (strain Pf0-1) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|A0KJS0|GUAA_AERHH GMP synthase [glutamine-hydrolyzing] OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|B4RV80|GUAA_ALTMD GMP synthase [glutamine-hydrolyzing] OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=guaA PE=3 SV=1 18 545 2.0E-164
sp|Q83BZ6|GUAA_COXBU GMP synthase [glutamine-hydrolyzing] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=guaA PE=1 SV=1 18 545 2.0E-164
sp|B0TLJ4|GUAA_SHEHH GMP synthase [glutamine-hydrolyzing] OS=Shewanella halifaxensis (strain HAW-EB4) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|Q8EC52|GUAA_SHEON GMP synthase [glutamine-hydrolyzing] OS=Shewanella oneidensis (strain MR-1) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|A9N8L6|GUAA_COXBR GMP synthase [glutamine-hydrolyzing] OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|B2SGK4|GUAA_FRATM GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|Q9PN49|GUAA_CAMJE GMP synthase [glutamine-hydrolyzing] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|C3K1K0|GUAA_PSEFS GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas fluorescens (strain SBW25) GN=guaA PE=3 SV=1 18 545 3.0E-164
sp|Q0HX50|GUAA_SHESR GMP synthase [glutamine-hydrolyzing] OS=Shewanella sp. (strain MR-7) GN=guaA PE=3 SV=1 18 545 4.0E-164
sp|A6TCC2|GUAA_KLEP7 GMP synthase [glutamine-hydrolyzing] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=guaA PE=3 SV=1 18 545 4.0E-164
sp|Q5NG38|GUAA_FRATT GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=guaA PE=3 SV=1 18 545 4.0E-164
sp|Q14HJ0|GUAA_FRAT1 GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=guaA PE=3 SV=1 18 545 4.0E-164
sp|Q47WD1|GUAA_COLP3 GMP synthase [glutamine-hydrolyzing] OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=guaA PE=3 SV=1 18 545 5.0E-164
sp|Q1I5K9|GUAA_PSEE4 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas entomophila (strain L48) GN=guaA PE=3 SV=1 18 545 5.0E-164
sp|B6IZE2|GUAA_COXB2 GMP synthase [glutamine-hydrolyzing] OS=Coxiella burnetii (strain CbuG_Q212) GN=guaA PE=3 SV=1 18 545 6.0E-164
sp|Q0HKV2|GUAA_SHESM GMP synthase [glutamine-hydrolyzing] OS=Shewanella sp. (strain MR-4) GN=guaA PE=3 SV=1 18 545 6.0E-164
sp|A0KUK2|GUAA_SHESA GMP synthase [glutamine-hydrolyzing] OS=Shewanella sp. (strain ANA-3) GN=guaA PE=3 SV=1 18 545 6.0E-164
sp|A0Q6C0|GUAA_FRATN GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. novicida (strain U112) GN=guaA PE=3 SV=1 18 545 6.0E-164
sp|Q87S07|GUAA_VIBPA GMP synthase [glutamine-hydrolyzing] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=guaA PE=3 SV=1 18 545 6.0E-164
sp|B5XNM4|GUAA_KLEP3 GMP synthase [glutamine-hydrolyzing] OS=Klebsiella pneumoniae (strain 342) GN=guaA PE=3 SV=1 18 545 7.0E-164
sp|Q3Z886|GUAA_DEHM1 GMP synthase [glutamine-hydrolyzing] OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=guaA PE=3 SV=1 16 545 7.0E-164
sp|A7MGU1|GUAA_CROS8 GMP synthase [glutamine-hydrolyzing] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=guaA PE=3 SV=1 18 545 8.0E-164
sp|B7VJU8|GUAA_VIBTL GMP synthase [glutamine-hydrolyzing] OS=Vibrio tasmaniensis (strain LGP32) GN=guaA PE=3 SV=1 18 545 9.0E-164
sp|C4K7H1|GUAA_HAMD5 GMP synthase [glutamine-hydrolyzing] OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=guaA PE=3 SV=1 18 545 1.0E-163
sp|Q0BLV0|GUAA_FRATO GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=guaA PE=3 SV=1 18 545 1.0E-163
sp|A7NCA3|GUAA_FRATF GMP synthase [glutamine-hydrolyzing] OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=guaA PE=3 SV=1 18 545 1.0E-163
sp|Q5HTL3|GUAA_CAMJR GMP synthase [glutamine-hydrolyzing] OS=Campylobacter jejuni (strain RM1221) GN=guaA PE=3 SV=1 18 545 1.0E-163
sp|A4XY17|GUAA_PSEMY GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas mendocina (strain ymp) GN=guaA PE=3 SV=1 18 545 2.0E-163
sp|A0Q2S8|GUAA_CLONN GMP synthase [glutamine-hydrolyzing] OS=Clostridium novyi (strain NT) GN=guaA PE=3 SV=1 16 545 2.0E-163
sp|Q3ZXH7|GUAA_DEHMC GMP synthase [glutamine-hydrolyzing] OS=Dehalococcoides mccartyi (strain CBDB1) GN=guaA PE=3 SV=1 16 545 2.0E-163
sp|A4WD82|GUAA_ENT38 GMP synthase [glutamine-hydrolyzing] OS=Enterobacter sp. (strain 638) GN=guaA PE=3 SV=1 18 545 2.0E-163
sp|A9KGD5|GUAA_COXBN GMP synthase [glutamine-hydrolyzing] OS=Coxiella burnetii (strain Dugway 5J108-111) GN=guaA PE=3 SV=1 18 545 4.0E-163
sp|B2TXT2|GUAA_SHIB3 GMP synthase [glutamine-hydrolyzing] OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=guaA PE=3 SV=1 18 545 4.0E-163
sp|Q5QWW5|GUAA_IDILO GMP synthase [glutamine-hydrolyzing] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=guaA PE=3 SV=1 18 545 4.0E-163
sp|Q3BSP7|GUAA_XANC5 GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=guaA PE=3 SV=1 16 545 6.0E-163
sp|Q5NYE5|GUAA_AROAE GMP synthase [glutamine-hydrolyzing] OS=Aromatoleum aromaticum (strain EbN1) GN=guaA PE=3 SV=1 14 545 6.0E-163
sp|Q5WVX4|GUAA_LEGPL GMP synthase [glutamine-hydrolyzing] OS=Legionella pneumophila (strain Lens) GN=guaA PE=3 SV=1 18 545 6.0E-163
sp|Q38ZE1|GUAA_LACSS GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=guaA PE=3 SV=1 8 545 7.0E-163
sp|A8AD80|GUAA_CITK8 GMP synthase [glutamine-hydrolyzing] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=guaA PE=3 SV=1 18 545 7.0E-163
sp|A5I720|GUAA_CLOBH GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=guaA PE=3 SV=1 16 545 7.0E-163
sp|A7FYP0|GUAA_CLOB1 GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=guaA PE=3 SV=1 16 545 7.0E-163
sp|Q5ZUS0|GUAA_LEGPH GMP synthase [glutamine-hydrolyzing] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=guaA PE=3 SV=1 18 545 7.0E-163
sp|Q3SI29|GUAA_THIDA GMP synthase [glutamine-hydrolyzing] OS=Thiobacillus denitrificans (strain ATCC 25259) GN=guaA PE=3 SV=1 15 545 7.0E-163
sp|Q9PAR6|GUAA_XYLFA GMP synthase [glutamine-hydrolyzing] OS=Xylella fastidiosa (strain 9a5c) GN=guaA PE=3 SV=1 11 545 9.0E-163
sp|A7GIN0|GUAA_CLOBL GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=guaA PE=3 SV=1 16 545 9.0E-163
sp|B1IFD1|GUAA_CLOBK GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Okra / Type B1) GN=guaA PE=3 SV=1 16 545 9.0E-163
sp|C1FLV2|GUAA_CLOBJ GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Kyoto / Type A2) GN=guaA PE=3 SV=1 16 545 1.0E-162
sp|B1L1J7|GUAA_CLOBM GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=guaA PE=3 SV=1 16 545 1.0E-162
sp|Q5X4I9|GUAA_LEGPA GMP synthase [glutamine-hydrolyzing] OS=Legionella pneumophila (strain Paris) GN=guaA PE=3 SV=1 18 545 1.0E-162
sp|B0U3R8|GUAA_XYLFM GMP synthase [glutamine-hydrolyzing] OS=Xylella fastidiosa (strain M12) GN=guaA PE=3 SV=1 11 545 1.0E-162
sp|B7LKD4|GUAA_ESCF3 GMP synthase [glutamine-hydrolyzing] OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=guaA PE=3 SV=1 18 545 1.0E-162
sp|B7UGU5|GUAA_ECO27 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|A1U1E2|GUAA_MARHV GMP synthase [glutamine-hydrolyzing] OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|Q6HPC6|GUAA_BACHK GMP synthase [glutamine-hydrolyzing] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=guaA PE=3 SV=1 13 545 2.0E-162
sp|Q1R8M9|GUAA_ECOUT GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain UTI89 / UPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B1LNF9|GUAA_ECOSM GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B6I579|GUAA_ECOSE GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain SE11) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B1IWF4|GUAA_ECOLC GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|P64294|GUAA_ECOL6 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|Q0TEY1|GUAA_ECOL5 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|A1AE43|GUAA_ECOK1 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O1:K1 / APEC GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|A8A313|GUAA_ECOHS GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O9:H4 (strain HS) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B7M7L1|GUAA_ECO8A GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O8 (strain IAI1) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B7MYD5|GUAA_ECO81 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O81 (strain ED1a) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B7NQV3|GUAA_ECO7I GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B5Z0X6|GUAA_ECO5E GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|P64295|GUAA_ECO57 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O157:H7 GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B7LCP7|GUAA_ECO55 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain 55989 / EAEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|B7MHY8|GUAA_ECO45 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=guaA PE=3 SV=1 18 545 2.0E-162
sp|Q87BK6|GUAA_XYLFT GMP synthase [glutamine-hydrolyzing] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=guaA PE=3 SV=1 11 545 3.0E-162
sp|B2I6W2|GUAA_XYLF2 GMP synthase [glutamine-hydrolyzing] OS=Xylella fastidiosa (strain M23) GN=guaA PE=3 SV=1 11 545 3.0E-162
sp|B7N691|GUAA_ECOLU GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|Q31XY3|GUAA_SHIBS GMP synthase [glutamine-hydrolyzing] OS=Shigella boydii serotype 4 (strain Sb227) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|B7JM61|GUAA_BACC0 GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain AH820) GN=guaA PE=3 SV=1 13 545 3.0E-162
sp|Q81VE0|GUAA_BACAN GMP synthase [glutamine-hydrolyzing] OS=Bacillus anthracis GN=guaA PE=3 SV=1 13 545 3.0E-162
sp|A8GHV1|GUAA_SERP5 GMP synthase [glutamine-hydrolyzing] OS=Serratia proteamaculans (strain 568) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|A7ZPV1|GUAA_ECO24 GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|B9KT27|GUAA_RHOSK GMP synthase [glutamine-hydrolyzing] OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=guaA PE=3 SV=1 15 545 3.0E-162
sp|Q3J210|GUAA_RHOS4 GMP synthase [glutamine-hydrolyzing] OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=guaA PE=3 SV=1 15 545 3.0E-162
sp|P04079|GUAA_ECOLI GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) GN=guaA PE=1 SV=1 18 545 3.0E-162
sp|B1XAY2|GUAA_ECODH GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain K12 / DH10B) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|C4ZX82|GUAA_ECOBW GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=guaA PE=3 SV=1 18 545 3.0E-162
sp|A6W2W4|GUAA_MARMS GMP synthase [glutamine-hydrolyzing] OS=Marinomonas sp. (strain MWYL1) GN=guaA PE=3 SV=1 18 545 4.0E-162
sp|Q73ER7|GUAA_BACC1 GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=guaA PE=3 SV=1 13 545 4.0E-162
sp|Q0T212|GUAA_SHIF8 GMP synthase [glutamine-hydrolyzing] OS=Shigella flexneri serotype 5b (strain 8401) GN=guaA PE=3 SV=1 18 545 4.0E-162
sp|Q83QL1|GUAA_SHIFL GMP synthase [glutamine-hydrolyzing] OS=Shigella flexneri GN=guaA PE=3 SV=1 18 545 4.0E-162
sp|Q15R63|GUAA_PSEA6 GMP synthase [glutamine-hydrolyzing] OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|B4EY59|GUAA_PROMH GMP synthase [glutamine-hydrolyzing] OS=Proteus mirabilis (strain HI4320) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|B5BAZ5|GUAA_SALPK GMP synthase [glutamine-hydrolyzing] OS=Salmonella paratyphi A (strain AKU_12601) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|C0PYP4|GUAA_SALPC GMP synthase [glutamine-hydrolyzing] OS=Salmonella paratyphi C (strain RKS4594) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|A9N218|GUAA_SALPB GMP synthase [glutamine-hydrolyzing] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|Q5PI52|GUAA_SALPA GMP synthase [glutamine-hydrolyzing] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|Q57LJ8|GUAA_SALCH GMP synthase [glutamine-hydrolyzing] OS=Salmonella choleraesuis (strain SC-B67) GN=guaA PE=3 SV=1 18 545 5.0E-162
sp|Q63GV4|GUAA_BACCZ GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain ZK / E33L) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|C1EUB4|GUAA_BACC3 GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain 03BB102) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|A0R8W7|GUAA_BACAH GMP synthase [glutamine-hydrolyzing] OS=Bacillus thuringiensis (strain Al Hakam) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|C3L508|GUAA_BACAC GMP synthase [glutamine-hydrolyzing] OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|C3PBL1|GUAA_BACAA GMP synthase [glutamine-hydrolyzing] OS=Bacillus anthracis (strain A0248) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|A9VQG9|GUAA_BACWK GMP synthase [glutamine-hydrolyzing] OS=Bacillus weihenstephanensis (strain KBAB4) GN=guaA PE=3 SV=1 13 545 6.0E-162
sp|A3PK79|GUAA_RHOS1 GMP synthase [glutamine-hydrolyzing] OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=guaA PE=3 SV=1 15 545 6.0E-162
sp|C3KUC5|GUAA_CLOB6 GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain 657 / Type Ba4) GN=guaA PE=3 SV=1 16 545 7.0E-162
sp|B2SLG1|GUAA_XANOP GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=guaA PE=3 SV=1 16 545 7.0E-162
sp|A4SM23|GUAA_AERS4 GMP synthase [glutamine-hydrolyzing] OS=Aeromonas salmonicida (strain A449) GN=guaA PE=3 SV=1 18 545 7.0E-162
sp|Q6D288|GUAA_PECAS GMP synthase [glutamine-hydrolyzing] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=guaA PE=3 SV=1 18 545 8.0E-162
sp|Q8Z4Q3|GUAA_SALTI GMP synthase [glutamine-hydrolyzing] OS=Salmonella typhi GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|B4TD82|GUAA_SALHS GMP synthase [glutamine-hydrolyzing] OS=Salmonella heidelberg (strain SL476) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|B5RCX9|GUAA_SALG2 GMP synthase [glutamine-hydrolyzing] OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|B5R569|GUAA_SALEP GMP synthase [glutamine-hydrolyzing] OS=Salmonella enteritidis PT4 (strain P125109) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|B5FR52|GUAA_SALDC GMP synthase [glutamine-hydrolyzing] OS=Salmonella dublin (strain CT_02021853) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|B5F185|GUAA_SALA4 GMP synthase [glutamine-hydrolyzing] OS=Salmonella agona (strain SL483) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|C5BLU3|GUAA_TERTT GMP synthase [glutamine-hydrolyzing] OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=guaA PE=3 SV=1 18 545 9.0E-162
sp|Q8ZN60|GUAA_SALTY GMP synthase [glutamine-hydrolyzing] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=guaA PE=3 SV=1 18 545 1.0E-161
sp|Q8P8Q6|GUAA_XANCP GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=guaA PE=3 SV=1 16 545 1.0E-161
sp|B0RSB6|GUAA_XANCB GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas campestris pv. campestris (strain B100) GN=guaA PE=3 SV=1 16 545 1.0E-161
sp|Q4UVC5|GUAA_XANC8 GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas campestris pv. campestris (strain 8004) GN=guaA PE=3 SV=1 16 545 1.0E-161
sp|Q5H0S2|GUAA_XANOR GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=guaA PE=3 SV=2 16 545 1.0E-161
sp|Q2P3Q9|GUAA_XANOM GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=guaA PE=3 SV=1 16 545 1.0E-161
sp|Q6FFN2|GUAA_ACIAD GMP synthase [glutamine-hydrolyzing] OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=guaA PE=3 SV=1 12 545 1.0E-161
sp|Q32D55|GUAA_SHIDS GMP synthase [glutamine-hydrolyzing] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=guaA PE=3 SV=1 18 545 1.0E-161
sp|B4TR83|GUAA_SALSV GMP synthase [glutamine-hydrolyzing] OS=Salmonella schwarzengrund (strain CVM19633) GN=guaA PE=3 SV=1 18 545 1.0E-161
sp|C6DBG3|GUAA_PECCP GMP synthase [glutamine-hydrolyzing] OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=guaA PE=3 SV=1 18 545 1.0E-161
sp|A8FMV3|GUAA_CAMJ8 GMP synthase [glutamine-hydrolyzing] OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=guaA PE=3 SV=1 18 545 1.0E-161
sp|A7GKG1|GUAA_BACCN GMP synthase [glutamine-hydrolyzing] OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=guaA PE=3 SV=1 13 545 2.0E-161
sp|A4TMS8|GUAA_YERPP GMP synthase [glutamine-hydrolyzing] OS=Yersinia pestis (strain Pestoides F) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|Q1CK82|GUAA_YERPN GMP synthase [glutamine-hydrolyzing] OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|A9R7Z2|GUAA_YERPG GMP synthase [glutamine-hydrolyzing] OS=Yersinia pestis bv. Antiqua (strain Angola) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|Q8ZCU4|GUAA_YERPE GMP synthase [glutamine-hydrolyzing] OS=Yersinia pestis GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|Q1C5J6|GUAA_YERPA GMP synthase [glutamine-hydrolyzing] OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|B4T0N7|GUAA_SALNS GMP synthase [glutamine-hydrolyzing] OS=Salmonella newport (strain SL254) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|Q02RS2|GUAA_PSEAB GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|A5ICM2|GUAA_LEGPC GMP synthase [glutamine-hydrolyzing] OS=Legionella pneumophila (strain Corby) GN=guaA PE=3 SV=1 18 545 2.0E-161
sp|B1JSB0|GUAA_YERPY GMP synthase [glutamine-hydrolyzing] OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|Q668A8|GUAA_YERPS GMP synthase [glutamine-hydrolyzing] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|B2K9P0|GUAA_YERPB GMP synthase [glutamine-hydrolyzing] OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|A7FFZ9|GUAA_YERP3 GMP synthase [glutamine-hydrolyzing] OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|Q9HXM6|GUAA_PSEAE GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|B7UXJ9|GUAA_PSEA8 GMP synthase [glutamine-hydrolyzing] OS=Pseudomonas aeruginosa (strain LESB58) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|Q8PK88|GUAA_XANAC GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=guaA PE=3 SV=1 16 545 3.0E-161
sp|Q3YZ45|GUAA_SHISS GMP synthase [glutamine-hydrolyzing] OS=Shigella sonnei (strain Ss046) GN=guaA PE=3 SV=1 18 545 3.0E-161
sp|Q8Y822|GUAA_LISMO GMP synthase [glutamine-hydrolyzing] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=guaA PE=3 SV=1 16 545 3.0E-161
sp|B2FNS1|GUAA_STRMK GMP synthase [glutamine-hydrolyzing] OS=Stenotrophomonas maltophilia (strain K279a) GN=guaA PE=3 SV=1 16 545 5.0E-161
sp|C4L8C4|GUAA_TOLAT GMP synthase [glutamine-hydrolyzing] OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=guaA PE=3 SV=1 18 545 6.0E-161
sp|Q7N3K4|GUAA_PHOLL GMP synthase [glutamine-hydrolyzing] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=guaA PE=3 SV=1 18 545 6.0E-161
sp|Q9JXR2|GUAA_NEIMB GMP synthase [glutamine-hydrolyzing] OS=Neisseria meningitidis serogroup B (strain MC58) GN=guaA PE=3 SV=1 16 545 6.0E-161
sp|B4SSX7|GUAA_STRM5 GMP synthase [glutamine-hydrolyzing] OS=Stenotrophomonas maltophilia (strain R551-3) GN=guaA PE=3 SV=1 16 545 6.0E-161
sp|Q9RT91|GUAA_DEIRA GMP synthase [glutamine-hydrolyzing] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=guaA PE=3 SV=1 17 545 7.0E-161
sp|Q92CU0|GUAA_LISIN GMP synthase [glutamine-hydrolyzing] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=guaA PE=3 SV=1 16 545 1.0E-160
sp|Q720X7|GUAA_LISMF GMP synthase [glutamine-hydrolyzing] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=guaA PE=3 SV=1 16 545 1.0E-160
sp|B7IUT1|GUAA_BACC2 GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain G9842) GN=guaA PE=3 SV=1 13 545 1.0E-160
sp|Q5L3E1|GUAA_GEOKA GMP synthase [glutamine-hydrolyzing] OS=Geobacillus kaustophilus (strain HTA426) GN=guaA PE=3 SV=1 16 545 1.0E-160
sp|C3LT21|GUAA_VIBCM GMP synthase [glutamine-hydrolyzing] OS=Vibrio cholerae serotype O1 (strain M66-2) GN=guaA PE=3 SV=1 18 545 1.0E-160
sp|Q9KTW2|GUAA_VIBCH GMP synthase [glutamine-hydrolyzing] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=guaA PE=3 SV=1 18 545 1.0E-160
sp|A5F3F1|GUAA_VIBC3 GMP synthase [glutamine-hydrolyzing] OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=guaA PE=3 SV=1 18 545 1.0E-160
sp|Q0A9W8|GUAA_ALKEH GMP synthase [glutamine-hydrolyzing] OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=guaA PE=3 SV=1 18 545 2.0E-160
sp|A9MHM5|GUAA_SALAR GMP synthase [glutamine-hydrolyzing] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=guaA PE=3 SV=1 18 545 2.0E-160
sp|A1JKT2|GUAA_YERE8 GMP synthase [glutamine-hydrolyzing] OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=guaA PE=3 SV=1 18 545 2.0E-160
sp|A3DCD4|GUAA_CLOTH GMP synthase [glutamine-hydrolyzing] OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=guaA PE=3 SV=1 16 545 3.0E-160
sp|A1W0N3|GUAA_CAMJJ GMP synthase [glutamine-hydrolyzing] OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=guaA PE=3 SV=1 18 545 3.0E-160
sp|Q74LF7|GUAA_LACJO GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=guaA PE=3 SV=1 15 545 3.0E-160
sp|A0AHK7|GUAA_LISW6 GMP synthase [glutamine-hydrolyzing] OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=guaA PE=3 SV=1 16 545 4.0E-160
sp|P44335|GUAA_HAEIN GMP synthase [glutamine-hydrolyzing] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=guaA PE=3 SV=1 15 545 4.0E-160
sp|A9M138|GUAA_NEIM0 GMP synthase [glutamine-hydrolyzing] OS=Neisseria meningitidis serogroup C (strain 053442) GN=guaA PE=3 SV=1 16 545 4.0E-160
sp|Q046I2|GUAA_LACGA GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=guaA PE=3 SV=1 15 545 4.0E-160
sp|A0RQD7|GUAA_CAMFF GMP synthase [glutamine-hydrolyzing] OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=guaA PE=3 SV=1 18 545 5.0E-160
sp|A7H2D2|GUAA_CAMJD GMP synthase [glutamine-hydrolyzing] OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=guaA PE=3 SV=1 18 545 6.0E-160
sp|A5UAR3|GUAA_HAEIE GMP synthase [glutamine-hydrolyzing] OS=Haemophilus influenzae (strain PittEE) GN=guaA PE=3 SV=1 18 545 8.0E-160
sp|A6QBI5|GUAA_SULNB GMP synthase [glutamine-hydrolyzing] OS=Sulfurovum sp. (strain NBC37-1) GN=guaA PE=3 SV=1 18 545 8.0E-160
sp|Q11WK3|GUAA_CYTH3 GMP synthase [glutamine-hydrolyzing] OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=guaA PE=3 SV=1 16 545 9.0E-160
sp|A4WTP4|GUAA_RHOS5 GMP synthase [glutamine-hydrolyzing] OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=guaA PE=3 SV=1 15 545 1.0E-159
sp|B7H4Q8|GUAA_BACC4 GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain B4264) GN=guaA PE=3 SV=1 13 545 1.0E-159
sp|B2G994|GUAA_LACRJ GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus reuteri (strain JCM 1112) GN=guaA PE=3 SV=1 14 545 1.0E-159
sp|A5VLY3|GUAA_LACRD GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus reuteri (strain DSM 20016) GN=guaA PE=3 SV=1 14 545 1.0E-159
sp|Q4QNW4|GUAA_HAEI8 GMP synthase [glutamine-hydrolyzing] OS=Haemophilus influenzae (strain 86-028NP) GN=guaA PE=3 SV=1 18 545 1.0E-159
sp|Q5F4X9|GUAA_NEIG1 GMP synthase [glutamine-hydrolyzing] OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=guaA PE=3 SV=1 16 545 1.0E-159
sp|A1KRY5|GUAA_NEIMF GMP synthase [glutamine-hydrolyzing] OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=guaA PE=3 SV=1 16 545 1.0E-159
sp|Q81IS3|GUAA_BACCR GMP synthase [glutamine-hydrolyzing] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=guaA PE=3 SV=1 13 545 1.0E-159
sp|Q6F1C4|GUAA_MESFL GMP synthase [glutamine-hydrolyzing] OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=guaA PE=3 SV=1 18 545 1.0E-159
sp|Q9CFJ0|GUAA_LACLA GMP synthase [glutamine-hydrolyzing] OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=guaA PE=3 SV=1 16 545 1.0E-159
sp|B4RJH7|GUAA_NEIG2 GMP synthase [glutamine-hydrolyzing] OS=Neisseria gonorrhoeae (strain NCCP11945) GN=guaA PE=3 SV=1 16 545 2.0E-159
sp|Q3IHJ1|GUAA_PSEHT GMP synthase [glutamine-hydrolyzing] OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=guaA PE=3 SV=1 18 545 2.0E-159
sp|A5UG27|GUAA_HAEIG GMP synthase [glutamine-hydrolyzing] OS=Haemophilus influenzae (strain PittGG) GN=guaA PE=3 SV=1 18 545 2.0E-159
sp|A6VMR9|GUAA_ACTSZ GMP synthase [glutamine-hydrolyzing] OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=guaA PE=3 SV=1 18 545 2.0E-159
sp|Q9JW60|GUAA_NEIMA GMP synthase [glutamine-hydrolyzing] OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=guaA PE=3 SV=1 16 545 3.0E-159
sp|Q5FMD6|GUAA_LACAC GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=guaA PE=3 SV=1 13 545 4.0E-159
sp|Q9CNX8|GUAA_PASMU GMP synthase [glutamine-hydrolyzing] OS=Pasteurella multocida (strain Pm70) GN=guaA PE=3 SV=1 18 545 4.0E-159
sp|Q65MU0|GUAA_BACLD GMP synthase [glutamine-hydrolyzing] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=guaA PE=3 SV=1 16 545 5.0E-159
sp|Q18CT8|GUAA_PEPD6 GMP synthase [glutamine-hydrolyzing] OS=Peptoclostridium difficile (strain 630) GN=guaA PE=3 SV=1 15 545 5.0E-159
sp|Q0AW22|GUAA_SYNWW GMP synthase [glutamine-hydrolyzing] OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=guaA PE=3 SV=1 16 545 5.0E-159
sp|Q9A7U9|GUAA_CAUCR GMP synthase [glutamine-hydrolyzing] OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=guaA PE=3 SV=1 18 545 6.0E-159
sp|B8GVI7|GUAA_CAUCN GMP synthase [glutamine-hydrolyzing] OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=guaA PE=3 SV=1 18 545 6.0E-159
sp|Q9Z6H4|GUAA_LACLM GMP synthase [glutamine-hydrolyzing] OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=guaA PE=3 SV=2 16 545 6.0E-159
sp|Q5WJI0|GUAA_BACSK GMP synthase [glutamine-hydrolyzing] OS=Bacillus clausii (strain KSM-K16) GN=guaA PE=3 SV=1 15 545 7.0E-159
sp|Q8DGA5|GUAA_THEEB GMP synthase [glutamine-hydrolyzing] OS=Thermosynechococcus elongatus (strain BP-1) GN=guaA PE=3 SV=1 18 545 7.0E-159
sp|A3MZV8|GUAA_ACTP2 GMP synthase [glutamine-hydrolyzing] OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=guaA PE=3 SV=1 18 545 2.0E-158
sp|B1ZNB4|GUAA_OPITP GMP synthase [glutamine-hydrolyzing] OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=guaA PE=3 SV=1 17 545 2.0E-158
sp|A2C5P2|GUAA_PROM3 GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain MIT 9303) GN=guaA PE=3 SV=1 5 545 2.0E-158
sp|Q4FVS5|GUAA_PSYA2 GMP synthase [glutamine-hydrolyzing] OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=guaA PE=3 SV=1 11 545 2.0E-158
sp|Q891G7|GUAA_CLOTE GMP synthase [glutamine-hydrolyzing] OS=Clostridium tetani (strain Massachusetts / E88) GN=guaA PE=3 SV=1 16 545 2.0E-158
sp|Q9KF78|GUAA_BACHD Putative GMP synthase [glutamine-hydrolyzing] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=guaA PE=3 SV=1 16 545 3.0E-158
sp|B2A5V5|GUAA_NATTJ GMP synthase [glutamine-hydrolyzing] OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=guaA PE=3 SV=1 16 545 3.0E-158
sp|Q88Y74|GUAA_LACPL GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=guaA PE=3 SV=1 8 545 4.0E-158
sp|Q7VVM4|GUAA_BORPE GMP synthase [glutamine-hydrolyzing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=guaA PE=3 SV=1 15 545 4.0E-158
sp|B0BUF0|GUAA_ACTPJ GMP synthase [glutamine-hydrolyzing] OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=guaA PE=3 SV=1 18 545 4.0E-158
sp|Q02Y87|GUAA_LACLS GMP synthase [glutamine-hydrolyzing] OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=guaA PE=3 SV=1 16 545 5.0E-158
sp|Q7VLE9|GUAA_HAEDU GMP synthase [glutamine-hydrolyzing] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=guaA PE=3 SV=1 18 545 8.0E-158
sp|A9IKK0|GUAA_BORPD GMP synthase [glutamine-hydrolyzing] OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=guaA PE=3 SV=1 15 545 1.0E-157
sp|Q7WK13|GUAA_BORBR GMP synthase [glutamine-hydrolyzing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=guaA PE=3 SV=1 15 545 1.0E-157
sp|B9DLM7|GUAA_STACT GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus carnosus (strain TM300) GN=guaA PE=3 SV=1 16 545 1.0E-157
sp|A8LKW5|GUAA_DINSH GMP synthase [glutamine-hydrolyzing] OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=guaA PE=3 SV=1 15 545 1.0E-157
sp|B8I4P0|GUAA_CLOCE GMP synthase [glutamine-hydrolyzing] OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=guaA PE=3 SV=1 16 545 1.0E-157
sp|B3H120|GUAA_ACTP7 GMP synthase [glutamine-hydrolyzing] OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=guaA PE=3 SV=1 18 545 3.0E-157
sp|A4XKX8|GUAA_CALS8 GMP synthase [glutamine-hydrolyzing] OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=guaA PE=3 SV=1 15 545 3.0E-157
sp|A1SYT6|GUAA_PSYIN GMP synthase [glutamine-hydrolyzing] OS=Psychromonas ingrahamii (strain 37) GN=guaA PE=3 SV=1 18 545 3.0E-157
sp|Q1WRY8|GUAA_LACS1 GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus salivarius (strain UCC118) GN=guaA PE=3 SV=1 8 545 4.0E-157
sp|Q65UI1|GUAA_MANSM GMP synthase [glutamine-hydrolyzing] OS=Mannheimia succiniciproducens (strain MBEL55E) GN=guaA PE=3 SV=1 18 545 4.0E-157
sp|Q7WAV6|GUAA_BORPA GMP synthase [glutamine-hydrolyzing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=guaA PE=3 SV=1 15 545 4.0E-157
sp|Q1J0T4|GUAA_DEIGD GMP synthase [glutamine-hydrolyzing] OS=Deinococcus geothermalis (strain DSM 11300) GN=guaA PE=3 SV=1 17 545 5.0E-157
sp|Q47LQ0|GUAA_THEFY GMP synthase [glutamine-hydrolyzing] OS=Thermobifida fusca (strain YX) GN=guaA PE=3 SV=1 8 545 5.0E-157
sp|A8LAX2|GUAA_FRASN GMP synthase [glutamine-hydrolyzing] OS=Frankia sp. (strain EAN1pec) GN=guaA PE=3 SV=1 12 545 8.0E-157
sp|A6LQ90|GUAA_CLOB8 GMP synthase [glutamine-hydrolyzing] OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=guaA PE=3 SV=1 16 545 1.0E-156
sp|A4SYS2|GUAA_POLSQ GMP synthase [glutamine-hydrolyzing] OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=guaA PE=3 SV=1 15 545 1.0E-156
sp|B0USI5|GUAA_HISS2 GMP synthase [glutamine-hydrolyzing] OS=Histophilus somni (strain 2336) GN=guaA PE=3 SV=1 18 545 2.0E-156
sp|A5N5D9|GUAA_CLOK5 GMP synthase [glutamine-hydrolyzing] OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=guaA PE=3 SV=1 16 545 2.0E-156
sp|B9DYY7|GUAA_CLOK1 GMP synthase [glutamine-hydrolyzing] OS=Clostridium kluyveri (strain NBRC 12016) GN=guaA PE=3 SV=1 16 545 2.0E-156
sp|Q2Y9R9|GUAA_NITMU GMP synthase [glutamine-hydrolyzing] OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=guaA PE=3 SV=1 15 545 2.0E-156
sp|Q04CA4|GUAA_LACDB GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=guaA PE=3 SV=1 15 545 3.0E-156
sp|Q1GBU7|GUAA_LACDA GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=guaA PE=3 SV=1 15 545 3.0E-156
sp|B0S0S7|GUAA_FINM2 GMP synthase [glutamine-hydrolyzing] OS=Finegoldia magna (strain ATCC 29328) GN=guaA PE=3 SV=1 18 545 3.0E-156
sp|P29727|GUAA_BACSU GMP synthase [glutamine-hydrolyzing] OS=Bacillus subtilis (strain 168) GN=guaA PE=3 SV=3 16 545 3.0E-156
sp|A8FAH5|GUAA_BACP2 GMP synthase [glutamine-hydrolyzing] OS=Bacillus pumilus (strain SAFR-032) GN=guaA PE=3 SV=1 16 545 4.0E-156
sp|Q97FM9|GUAA_CLOAB GMP synthase [glutamine-hydrolyzing] OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=guaA PE=3 SV=1 18 545 4.0E-156
sp|Q7UA53|GUAA_SYNPX GMP synthase [glutamine-hydrolyzing] OS=Synechococcus sp. (strain WH8102) GN=guaA PE=3 SV=1 5 545 4.0E-156
sp|P49057|GUAA_SYNY3 GMP synthase [glutamine-hydrolyzing] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=guaA PE=3 SV=1 18 545 5.0E-156
sp|B8F3T2|GUAA_HAEPS GMP synthase [glutamine-hydrolyzing] OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=guaA PE=3 SV=1 18 545 7.0E-156
sp|Q31F66|GUAA_THICR GMP synthase [glutamine-hydrolyzing] OS=Thiomicrospira crunogena (strain XCL-2) GN=guaA PE=3 SV=1 18 545 2.0E-155
sp|B1XTW6|GUAA_POLNS GMP synthase [glutamine-hydrolyzing] OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=guaA PE=3 SV=1 15 545 2.0E-155
sp|Q0I2D2|GUAA_HAES1 GMP synthase [glutamine-hydrolyzing] OS=Haemophilus somnus (strain 129Pt) GN=guaA PE=3 SV=1 18 545 2.0E-155
sp|A4G4U7|GUAA_HERAR GMP synthase [glutamine-hydrolyzing] OS=Herminiimonas arsenicoxydans GN=guaA PE=3 SV=1 15 545 3.0E-155
sp|Q3ANK7|GUAA_SYNSC GMP synthase [glutamine-hydrolyzing] OS=Synechococcus sp. (strain CC9605) GN=guaA PE=3 SV=1 5 545 4.0E-155
sp|Q8YT80|GUAA_NOSS1 GMP synthase [glutamine-hydrolyzing] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=guaA PE=3 SV=1 18 545 4.0E-155
sp|B2KCS8|GUAA_ELUMP GMP synthase [glutamine-hydrolyzing] OS=Elusimicrobium minutum (strain Pei191) GN=guaA PE=3 SV=1 18 545 5.0E-155
sp|B9L0W3|GUAA_THERP GMP synthase [glutamine-hydrolyzing] OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=guaA PE=3 SV=1 14 545 5.0E-155
sp|Q49UU9|GUAA_STAS1 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=guaA PE=3 SV=1 16 545 5.0E-155
sp|Q1GGV8|GUAA_RUEST GMP synthase [glutamine-hydrolyzing] OS=Ruegeria sp. (strain TM1040) GN=guaA PE=3 SV=1 14 545 5.0E-155
sp|A7Z235|GUAA_BACMF GMP synthase [glutamine-hydrolyzing] OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=guaA PE=3 SV=1 16 545 6.0E-155
sp|C1D0M2|GUAA_DEIDV GMP synthase [glutamine-hydrolyzing] OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=guaA PE=3 SV=1 17 545 6.0E-155
sp|Q03H14|GUAA_PEDPA GMP synthase [glutamine-hydrolyzing] OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=guaA PE=3 SV=1 8 545 8.0E-155
sp|Q2YVL5|GUAA_STAAB GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=guaA PE=3 SV=1 16 545 9.0E-155
sp|Q3MEA8|GUAA_ANAVT GMP synthase [glutamine-hydrolyzing] OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=guaA PE=3 SV=1 18 545 1.0E-154
sp|Q5LRL6|GUAA_RUEPO GMP synthase [glutamine-hydrolyzing] OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=guaA PE=3 SV=1 14 545 1.0E-154
sp|Q8XI46|GUAA_CLOPE GMP synthase [glutamine-hydrolyzing] OS=Clostridium perfringens (strain 13 / Type A) GN=guaA PE=3 SV=1 16 545 2.0E-154
sp|B7JXM2|GUAA_CYAP8 GMP synthase [glutamine-hydrolyzing] OS=Cyanothece sp. (strain PCC 8801) GN=guaA PE=3 SV=1 18 545 3.0E-154
sp|Q6GJQ6|GUAA_STAAR GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain MRSA252) GN=guaA PE=3 SV=1 16 545 3.0E-154
sp|P99105|GUAA_STAAN GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain N315) GN=guaA PE=1 SV=1 16 545 3.0E-154
sp|P64296|GUAA_STAAM GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=guaA PE=3 SV=1 16 545 3.0E-154
sp|A5IPX0|GUAA_STAA9 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain JH9) GN=guaA PE=3 SV=1 16 545 3.0E-154
sp|A6TYP2|GUAA_STAA2 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain JH1) GN=guaA PE=3 SV=1 16 545 3.0E-154
sp|A7WY93|GUAA_STAA1 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=guaA PE=3 SV=1 16 545 3.0E-154
sp|Q46I26|GUAA_PROMT GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain NATL2A) GN=guaA PE=3 SV=1 17 545 4.0E-154
sp|Q7VEH5|GUAA_PROMA GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=guaA PE=3 SV=1 13 545 4.0E-154
sp|A9AIP4|GUAA_BURM1 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=guaA PE=3 SV=1 15 545 5.0E-154
sp|Q0IE37|GUAA_SYNS3 GMP synthase [glutamine-hydrolyzing] OS=Synechococcus sp. (strain CC9311) GN=guaA PE=3 SV=1 5 545 6.0E-154
sp|A8Z0R1|GUAA_STAAT GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=guaA PE=3 SV=1 16 545 6.0E-154
sp|A6QE71|GUAA_STAAE GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain Newman) GN=guaA PE=3 SV=1 16 545 6.0E-154
sp|Q5HIQ6|GUAA_STAAC GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain COL) GN=guaA PE=3 SV=1 16 545 6.0E-154
sp|Q2G0Y6|GUAA_STAA8 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain NCTC 8325) GN=guaA PE=3 SV=1 16 545 6.0E-154
sp|Q2FJM5|GUAA_STAA3 GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain USA300) GN=guaA PE=3 SV=1 16 545 6.0E-154
sp|Q8NY69|GUAA_STAAW GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain MW2) GN=guaA PE=3 SV=1 16 545 7.0E-154
sp|Q6GC81|GUAA_STAAS GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus aureus (strain MSSA476) GN=guaA PE=3 SV=1 16 545 7.0E-154
sp|A2BZD9|GUAA_PROM1 GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain NATL1A) GN=guaA PE=3 SV=1 17 545 9.0E-154
sp|Q2L1U0|GUAA_BORA1 GMP synthase [glutamine-hydrolyzing] OS=Bordetella avium (strain 197N) GN=guaA PE=3 SV=1 15 545 2.0E-153
sp|B1YIZ1|GUAA_EXIS2 GMP synthase [glutamine-hydrolyzing] OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=guaA PE=3 SV=1 12 545 2.0E-153
sp|O85192|GUAA_LACRH GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus rhamnosus GN=guaA PE=3 SV=1 8 545 2.0E-153
sp|Q7NHC2|GUAA_GLOVI GMP synthase [glutamine-hydrolyzing] OS=Gloeobacter violaceus (strain PCC 7421) GN=guaA PE=3 SV=1 8 545 3.0E-153
sp|B2J9G3|GUAA_NOSP7 GMP synthase [glutamine-hydrolyzing] OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=guaA PE=3 SV=1 18 545 4.0E-153
sp|B9MS76|GUAA_CALBD GMP synthase [glutamine-hydrolyzing] OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=guaA PE=3 SV=1 15 545 4.0E-153
sp|Q4FMW8|GUAA_PELUB GMP synthase [glutamine-hydrolyzing] OS=Pelagibacter ubique (strain HTCC1062) GN=guaA PE=3 SV=1 18 545 5.0E-153
sp|A3NAR3|GUAA_BURP6 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia pseudomallei (strain 668) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|A3NWJ3|GUAA_BURP0 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia pseudomallei (strain 1106a) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|A1V534|GUAA_BURMS GMP synthase [glutamine-hydrolyzing] OS=Burkholderia mallei (strain SAVP1) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|Q62JF6|GUAA_BURMA GMP synthase [glutamine-hydrolyzing] OS=Burkholderia mallei (strain ATCC 23344) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|A2SBA7|GUAA_BURM9 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia mallei (strain NCTC 10229) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|A3MKQ7|GUAA_BURM7 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia mallei (strain NCTC 10247) GN=guaA PE=3 SV=1 15 545 6.0E-153
sp|B2IQR1|GUAA_STRPS GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain CGSP14) GN=guaA PE=3 SV=1 13 545 8.0E-153
sp|Q64XQ7|GUAA_BACFR GMP synthase [glutamine-hydrolyzing] OS=Bacteroides fragilis (strain YCH46) GN=guaA PE=3 SV=1 16 545 9.0E-153
sp|Q5LGV6|GUAA_BACFN GMP synthase [glutamine-hydrolyzing] OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=guaA PE=3 SV=1 16 545 9.0E-153
sp|Q5N2F8|GUAA_SYNP6 GMP synthase [glutamine-hydrolyzing] OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=guaA PE=3 SV=1 16 545 1.0E-152
sp|B7K8T7|GUAA_CYAP7 GMP synthase [glutamine-hydrolyzing] OS=Cyanothece sp. (strain PCC 7424) GN=guaA PE=3 SV=1 18 545 1.0E-152
sp|C0MFC7|GUAA_STRS7 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=guaA PE=3 SV=1 18 545 1.0E-152
sp|Q0BE45|GUAA_BURCM GMP synthase [glutamine-hydrolyzing] OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=guaA PE=3 SV=1 15 545 1.0E-152
sp|A4JF45|GUAA_BURVG GMP synthase [glutamine-hydrolyzing] OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=guaA PE=3 SV=1 15 545 2.0E-152
sp|Q2GHY2|GUAA_EHRCR GMP synthase [glutamine-hydrolyzing] OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=guaA PE=3 SV=1 18 545 2.0E-152
sp|B1YS44|GUAA_BURA4 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia ambifaria (strain MC40-6) GN=guaA PE=3 SV=1 15 545 2.0E-152
sp|Q63T42|GUAA_BURPS GMP synthase [glutamine-hydrolyzing] OS=Burkholderia pseudomallei (strain K96243) GN=guaA PE=3 SV=1 15 545 2.0E-152
sp|Q3JR65|GUAA_BURP1 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia pseudomallei (strain 1710b) GN=guaA PE=3 SV=1 15 545 2.0E-152
sp|A2BTY4|GUAA_PROM5 GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain MIT 9515) GN=guaA PE=3 SV=1 17 545 2.0E-152
sp|Q7V9A9|GUAA_PROMM GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain MIT 9313) GN=guaA PE=3 SV=1 7 545 3.0E-152
sp|Q47DK8|GUAA_DECAR GMP synthase [glutamine-hydrolyzing] OS=Dechloromonas aromatica (strain RCB) GN=guaA PE=3 SV=1 14 545 3.0E-152
sp|C1CQS0|GUAA_STRZT GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|P64298|GUAA_STRR6 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|P64297|GUAA_STRPN GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|B1ICM9|GUAA_STRPI GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|C1C842|GUAA_STRP7 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain 70585) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|B5E5U0|GUAA_STRP4 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|Q04JQ8|GUAA_STRP2 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=guaA PE=3 SV=1 13 545 3.0E-152
sp|Q165N4|GUAA_ROSDO GMP synthase [glutamine-hydrolyzing] OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=guaA PE=3 SV=1 15 545 3.0E-152
sp|Q5HRX1|GUAA_STAEQ GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=guaA PE=3 SV=1 16 545 4.0E-152
sp|A6SZM5|GUAA_JANMA GMP synthase [glutamine-hydrolyzing] OS=Janthinobacterium sp. (strain Marseille) GN=guaA PE=3 SV=1 15 545 4.0E-152
sp|Q3YT30|GUAA_EHRCJ GMP synthase [glutamine-hydrolyzing] OS=Ehrlichia canis (strain Jake) GN=guaA PE=3 SV=1 18 545 4.0E-152
sp|Q72IE5|GUAA_THET2 GMP synthase [glutamine-hydrolyzing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=guaA PE=3 SV=1 18 545 6.0E-152
sp|Q4L386|GUAA_STAHJ GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus haemolyticus (strain JCSC1435) GN=guaA PE=3 SV=1 13 545 6.0E-152
sp|Q39F73|GUAA_BURL3 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=guaA PE=3 SV=1 15 545 8.0E-152
sp|Q8XZG4|GUAA_RALSO GMP synthase [glutamine-hydrolyzing] OS=Ralstonia solanacearum (strain GMI1000) GN=guaA PE=3 SV=1 12 545 9.0E-152
sp|A0K8B3|GUAA_BURCH GMP synthase [glutamine-hydrolyzing] OS=Burkholderia cenocepacia (strain HI2424) GN=guaA PE=3 SV=1 15 545 1.0E-151
sp|B1JUC0|GUAA_BURCC GMP synthase [glutamine-hydrolyzing] OS=Burkholderia cenocepacia (strain MC0-3) GN=guaA PE=3 SV=1 15 545 1.0E-151
sp|Q1BHF2|GUAA_BURCA GMP synthase [glutamine-hydrolyzing] OS=Burkholderia cenocepacia (strain AU 1054) GN=guaA PE=3 SV=1 15 545 1.0E-151
sp|B1WY30|GUAA_CYAA5 GMP synthase [glutamine-hydrolyzing] OS=Cyanothece sp. (strain ATCC 51142) GN=guaA PE=3 SV=1 18 545 1.0E-151
sp|C1CLE8|GUAA_STRZP GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain P1031) GN=guaA PE=3 SV=1 13 545 1.0E-151
sp|Q3B0W1|GUAA_SYNS9 GMP synthase [glutamine-hydrolyzing] OS=Synechococcus sp. (strain CC9902) GN=guaA PE=3 SV=1 5 545 1.0E-151
sp|A2SG95|GUAA_METPP GMP synthase [glutamine-hydrolyzing] OS=Methylibium petroleiphilum (strain PM1) GN=guaA PE=3 SV=1 15 545 1.0E-151
sp|Q8CMQ8|GUAA_STAES GMP synthase [glutamine-hydrolyzing] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=guaA PE=3 SV=1 16 545 2.0E-151
sp|C5CBZ4|GUAA_MICLC GMP synthase [glutamine-hydrolyzing] OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=guaA PE=3 SV=1 17 545 3.0E-151
sp|Q5SI28|GUAA_THET8 GMP synthase [glutamine-hydrolyzing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=guaA PE=1 SV=1 18 545 4.0E-151
sp|B2TIX3|GUAA_CLOBB GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=guaA PE=3 SV=1 16 545 4.0E-151
sp|B2UZ05|GUAA_CLOBA GMP synthase [glutamine-hydrolyzing] OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=guaA PE=3 SV=1 16 545 4.0E-151
sp|Q470G4|GUAA_CUPPJ GMP synthase [glutamine-hydrolyzing] OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=guaA PE=3 SV=1 15 545 6.0E-151
sp|Q73LZ4|GUAA_TREDE GMP synthase [glutamine-hydrolyzing] OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=guaA PE=3 SV=1 16 545 7.0E-151
sp|Q7V3N7|GUAA_PROMP GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=guaA PE=3 SV=1 17 545 9.0E-151
sp|C1CF29|GUAA_STRZJ GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain JJA) GN=guaA PE=3 SV=1 13 545 9.0E-151
sp|B8ZKZ5|GUAA_STRPJ GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=guaA PE=3 SV=1 13 545 9.0E-151
sp|A5FHB4|GUAA_FLAJ1 GMP synthase [glutamine-hydrolyzing] OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=guaA PE=3 SV=1 17 545 1.0E-150
sp|B3W952|GUAA_LACCB GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus casei (strain BL23) GN=guaA PE=3 SV=1 8 545 1.0E-150
sp|Q036Y5|GUAA_LACC3 GMP synthase [glutamine-hydrolyzing] OS=Lactobacillus casei (strain ATCC 334) GN=guaA PE=3 SV=1 8 545 1.0E-150
sp|B5XLN9|GUAA_STRPZ GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|Q48TF6|GUAA_STRPM GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|Q1J6G5|GUAA_STRPF GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|P64300|GUAA_STRP8 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|P64299|GUAA_STRP1 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M1 GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|P0DB55|GUAA_STRPQ GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|P0DB54|GUAA_STRP3 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|A2RED2|GUAA_STRPG GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=guaA PE=3 SV=1 18 545 1.0E-150
sp|Q31DE7|GUAA_PROM9 GMP synthase [glutamine-hydrolyzing] OS=Prochlorococcus marinus (strain MIT 9312) GN=guaA PE=3 SV=1 17 545 1.0E-150
sp|A6TLR3|GUAA_ALKMQ GMP synthase [glutamine-hydrolyzing] OS=Alkaliphilus metalliredigens (strain QYMF) GN=guaA PE=3 SV=1 16 545 2.0E-150
sp|Q5XC20|GUAA_STRP6 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=guaA PE=3 SV=1 18 545 2.0E-150
sp|Q1LSJ1|GUAA_BAUCH GMP synthase [glutamine-hydrolyzing] OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=guaA PE=3 SV=1 18 545 2.0E-150
sp|Q1LND0|GUAA_CUPMC GMP synthase [glutamine-hydrolyzing] OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=guaA PE=3 SV=1 15 545 3.0E-150
sp|Q1JLL1|GUAA_STRPC GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=guaA PE=3 SV=1 18 545 4.0E-150
sp|Q1JBM8|GUAA_STRPB GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=guaA PE=3 SV=1 18 545 4.0E-150
sp|B4EC68|GUAA_BURCJ GMP synthase [glutamine-hydrolyzing] OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=guaA PE=3 SV=1 15 545 5.0E-150
sp|Q5M4P4|GUAA_STRT2 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=guaA PE=3 SV=1 18 545 6.0E-150
sp|Q1JGP6|GUAA_STRPD GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=guaA PE=3 SV=1 18 545 7.0E-150
sp|C0MAM2|GUAA_STRE4 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus equi subsp. equi (strain 4047) GN=guaA PE=3 SV=1 18 545 7.0E-150
sp|A9BER7|GUAA_PETMO GMP synthase [glutamine-hydrolyzing] OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=guaA PE=3 SV=1 16 545 8.0E-150
[Show less]

GO

GO Term Description Terminal node
GO:0006177 GMP biosynthetic process Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003922 GMP synthase (glutamine-hydrolyzing) activity Yes
GO:0006164 purine nucleotide biosynthetic process Yes
GO:0043167 ion binding No
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0019693 ribose phosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0043168 anion binding No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016874 ligase activity No
GO:0006163 purine nucleotide metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0036094 small molecule binding No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0019637 organophosphate metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0000166 nucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0044281 small molecule metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0009987 cellular process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0005488 binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0009117 nucleotide metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0017076 purine nucleotide binding No
GO:0018130 heterocycle biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046037 GMP metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0044237 cellular metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2275
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5988 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2038
Ophiocordyceps camponoti-floridani Ophcf2|02007
Ophiocordyceps camponoti-rufipedis Ophun1|2944
Ophiocordyceps kimflemingae Ophio5|1387
Ophiocordyceps subramaniannii Hirsu2|2997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5988
MSGAIDQAEAPHQAYDTILTLDFGSQLTHLITRRLRELNVYSEMLPCTTKLSELTWRPKGIILSGGPCSVYDKDA
PHCDPAFFDLNVPVLGICYGLQELAWRLGKDNVIAGTEREYGHALLKAQRHNTHVDRLFDGMHDCGDSQVWMSHG
DKLSKLPQHFCTIATTQNSPYAAIAHETEPIFGLQFHPEVTHTLRGTEILKNFAIGICNAKPNWNMSNFIEQEIK
RIRKLVGDKGQVIGAVSGGVDSTVAAKLMKEAIGDRFHAVLVDNGVMRLDECRQVKQTLAEHMKINLTIADASQR
FLNGLNGVVDPEKKRKIIGNTFYDVFEEQAMEIEKAAQNTPNAGKVEWFLQGTLYPDVIESISFKGPSATIKTHH
NVGGLPKRMMEGQGLKLIEPLRELFKDEVRSLGRELGINEELVMRHPFPGPGIAIRILGEVTPERVEIARMADYI
FISMIKEANIYNKISQAYAALDTNKAVGVMGDKRQEGYIIILRAVVTTDFMTAEAYHFDMDFLMKVSRRIVNEVD
GVSCVTYNTTSKPPATIEMQ*
Coding >OphauG2|5988
ATGTCGGGGGCAATTGACCAGGCCGAAGCGCCTCACCAGGCCTACGATACTATCCTCACACTCGACTTTGGCTCT
CAGTTAACGCACCTCATCACCCGACGGCTAAGAGAACTCAATGTATACAGCGAGATGCTGCCGTGCACGACAAAG
CTATCCGAGTTGACCTGGAGACCCAAGGGCATAATTCTCTCCGGTGGTCCTTGCTCTGTGTATGACAAGGACGCT
CCTCACTGCGACCCGGCATTCTTTGATCTCAATGTTCCCGTTTTGGGCATATGTTATGGTCTTCAGGAGCTGGCA
TGGAGACTTGGAAAAGATAATGTCATTGCAGGCACTGAGCGCGAGTATGGCCATGCTCTCCTCAAGGCCCAGCGC
CACAACACGCATGTTGATCGCCTCTTTGACGGCATGCACGATTGCGGCGATAGTCAAGTTTGGATGAGCCACGGC
GACAAGCTTAGCAAACTACCCCAACACTTCTGCACCATCGCCACCACCCAGAATTCCCCCTATGCTGCCATTGCA
CATGAGACCGAGCCCATCTTTGGCCTCCAGTTCCATCCAGAGGTCACCCATACGCTGCGAGGCACCGAGATATTA
AAAAACTTTGCCATAGGCATATGCAATGCCAAGCCGAATTGGAACATGTCCAACTTCATTGAACAGGAAATCAAG
CGTATTCGCAAGCTAGTCGGCGACAAGGGTCAGGTCATTGGCGCCGTCTCCGGGGGTGTTGATTCCACCGTAGCT
GCCAAGCTCATGAAGGAGGCTATTGGCGATAGATTTCATGCCGTTCTCGTCGACAATGGCGTGATGCGCCTAGAC
GAGTGTCGCCAGGTCAAGCAAACACTTGCTGAACATATGAAAATTAATCTCACCATTGCAGACGCGTCACAAAGG
TTTCTCAATGGACTCAATGGTGTTGTAGATCCGGAGAAAAAACGCAAAATTATCGGCAATACTTTTTACGATGTT
TTTGAGGAGCAGGCCATGGAGATTGAAAAGGCTGCCCAAAACACGCCTAATGCAGGCAAGGTGGAATGGTTTCTA
CAGGGAACACTCTATCCAGATGTCATTGAGTCCATCTCCTTCAAGGGCCCCTCAGCAACTATCAAGACACACCAC
AACGTTGGCGGACTGCCAAAACGCATGATGGAGGGCCAGGGACTCAAACTGATTGAGCCTCTCAGAGAGCTCTTC
AAAGACGAGGTTCGAAGCCTCGGGCGCGAGCTAGGCATCAACGAAGAGCTTGTCATGAGACACCCCTTTCCCGGT
CCTGGAATTGCTATTCGAATCTTGGGTGAAGTTACCCCTGAACGTGTCGAAATCGCAAGAATGGCAGATTACATC
TTTATAAGCATGATCAAGGAGGCGAATATCTACAACAAGATTAGCCAAGCGTATGCTGCGTTGGACACGAACAAG
GCTGTTGGTGTCATGGGCGATAAGCGACAAGAAGGATATATTATTATCCTTCGCGCAGTGGTTACAACAGACTTT
ATGACGGCTGAGGCATATCACTTTGATATGGACTTTCTCATGAAGGTGTCTAGGCGCATAGTCAACGAAGTTGAC
GGAGTAAGTTGTGTTACGTATAACACGACGAGCAAACCTCCAGCTACAATTGAGATGCAGTAG
Transcript >OphauG2|5988
ATGTCGGGGGCAATTGACCAGGCCGAAGCGCCTCACCAGGCCTACGATACTATCCTCACACTCGACTTTGGCTCT
CAGTTAACGCACCTCATCACCCGACGGCTAAGAGAACTCAATGTATACAGCGAGATGCTGCCGTGCACGACAAAG
CTATCCGAGTTGACCTGGAGACCCAAGGGCATAATTCTCTCCGGTGGTCCTTGCTCTGTGTATGACAAGGACGCT
CCTCACTGCGACCCGGCATTCTTTGATCTCAATGTTCCCGTTTTGGGCATATGTTATGGTCTTCAGGAGCTGGCA
TGGAGACTTGGAAAAGATAATGTCATTGCAGGCACTGAGCGCGAGTATGGCCATGCTCTCCTCAAGGCCCAGCGC
CACAACACGCATGTTGATCGCCTCTTTGACGGCATGCACGATTGCGGCGATAGTCAAGTTTGGATGAGCCACGGC
GACAAGCTTAGCAAACTACCCCAACACTTCTGCACCATCGCCACCACCCAGAATTCCCCCTATGCTGCCATTGCA
CATGAGACCGAGCCCATCTTTGGCCTCCAGTTCCATCCAGAGGTCACCCATACGCTGCGAGGCACCGAGATATTA
AAAAACTTTGCCATAGGCATATGCAATGCCAAGCCGAATTGGAACATGTCCAACTTCATTGAACAGGAAATCAAG
CGTATTCGCAAGCTAGTCGGCGACAAGGGTCAGGTCATTGGCGCCGTCTCCGGGGGTGTTGATTCCACCGTAGCT
GCCAAGCTCATGAAGGAGGCTATTGGCGATAGATTTCATGCCGTTCTCGTCGACAATGGCGTGATGCGCCTAGAC
GAGTGTCGCCAGGTCAAGCAAACACTTGCTGAACATATGAAAATTAATCTCACCATTGCAGACGCGTCACAAAGG
TTTCTCAATGGACTCAATGGTGTTGTAGATCCGGAGAAAAAACGCAAAATTATCGGCAATACTTTTTACGATGTT
TTTGAGGAGCAGGCCATGGAGATTGAAAAGGCTGCCCAAAACACGCCTAATGCAGGCAAGGTGGAATGGTTTCTA
CAGGGAACACTCTATCCAGATGTCATTGAGTCCATCTCCTTCAAGGGCCCCTCAGCAACTATCAAGACACACCAC
AACGTTGGCGGACTGCCAAAACGCATGATGGAGGGCCAGGGACTCAAACTGATTGAGCCTCTCAGAGAGCTCTTC
AAAGACGAGGTTCGAAGCCTCGGGCGCGAGCTAGGCATCAACGAAGAGCTTGTCATGAGACACCCCTTTCCCGGT
CCTGGAATTGCTATTCGAATCTTGGGTGAAGTTACCCCTGAACGTGTCGAAATCGCAAGAATGGCAGATTACATC
TTTATAAGCATGATCAAGGAGGCGAATATCTACAACAAGATTAGCCAAGCGTATGCTGCGTTGGACACGAACAAG
GCTGTTGGTGTCATGGGCGATAAGCGACAAGAAGGATATATTATTATCCTTCGCGCAGTGGTTACAACAGACTTT
ATGACGGCTGAGGCATATCACTTTGATATGGACTTTCTCATGAAGGTGTCTAGGCGCATAGTCAACGAAGTTGAC
GGAGTAAGTTGTGTTACGTATAACACGACGAGCAAACCTCCAGCTACAATTGAGATGCAGTAG
Gene >OphauG2|5988
ATGTCGGGGGCAATTGACCAGGCCGAAGCGCCTCACCAGGCCTACGATACTATCCTCACACTCGACTTTGGCTCT
CAGTTAACGCACCTCATCACCCGACGGCTAAGAGAACTCAATGTATACAGCGAGATGCTGCCGTGCACGACAAAG
CTATCCGAGTTGACCTGGAGACCCAAGGGCATAATTCTCTCCGGTGGTCCTTGCTCTGTGTATGACAAGGACGCT
CCTCACTGCGACCCGGCATTCTTTGATCTCAATGTTCCCGTTTTGGGCATATGTTATGGTCTTCAGGAGCTGGCA
TGGAGACTTGGAAAAGATAATGTCATTGCAGGCACTGAGCGCGAGTATGGCCATGCTCTCCTCAAGGCCCAGCGC
CACAACACGCATGTTGATCGCCTCTTTGACGGCATGCACGATTGCGGCGATAGTCAAGTTTGGATGAGCCACGGC
GACAAGCTTAGCAAACTACCCCAACACTTCTGCACCATCGCCACCACCCAGAATTCCCCCTATGCTGCCATTGCA
CATGAGACCGAGCCCATCTTTGGCCTCCAGTTCCATCCAGAGGTCACCCATACGCTGCGAGGCACCGAGATATTA
AAAAACTTTGCCATAGGCATATGCAATGCCAAGCCGAATTGGAACATGTCCAACTTCATTGAACAGGAAATCAAG
CGTATTCGCAAGCTAGTCGGCGACAAGGGTCAGGTCATTGGCGCCGTCTCCGGGGGTGTTGATTCCACCGTAGCT
GCCAAGCTCATGAAGGAGGCTATTGGCGATAGATTTCATGCCGTTCTCGTCGACAATGGCGTGATGCGCCTAGAC
GAGTGTCGCCAGGTCAAGCAAACACTTGCTGAACATATGAAAATTAATCTCACCATTGCAGACGCGTCACAAAGG
TTTCTCAATGGACTCAATGGTGTTGTAGATCCGGAGAAAAAACGCAAAATTATCGGCAATACTTTTTACGATGTT
TTTGAGGAGCAGGCCATGGAGATTGAAAAGGCTGCCCAAAACACGCCTAATGCAGGCAAGGTGGAATGGTTTCTA
CAGGGAACACTCTATCCAGATGTCATTGAGTCCATCTCCTTCAAGGGCCCCTCAGCAACTATCAAGACACACCAC
AACGTTGGCGGACTGCCAAAACGCATGATGGAGGGCCAGGGACTCAAACTGATTGAGCCTCTCAGAGAGCTCTTC
AAAGACGAGGTTCGAAGCCTCGGGCGCGAGCTAGGCATCAACGAAGAGCTTGTCATGAGACACCCCTTTCCCGGT
CCTGGAATTGCTATTCGAATCTTGGGTGAAGTTACCCCTGAACGTGTCGAAATCGCAAGAATGGCAGATTACATC
TTTATAAGCATGATCAAGGAGGCGAATATCTACAACAAGATTAGCCAAGCGTATGCTGCGTTGGACACGAACAAG
GCTGTTGGTGTCATGGGCGATAAGCGACAAGAAGGATATATTATTATCCTTCGCGCAGTGGTTACAACAGACTTT
ATGACGGCTGAGGCATATCACTTTGATATGGACTTTCTCATGAAGGTGTCTAGGCGCATAGTCAACGAAGTTGAC
GGAGTAAGTTGTGTTACGTATAACACGACGAGCAAACCTCCAGCTACAATTGAGATGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail