Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5983
Gene name
LocationContig_584:4821..6115
Strand-
Gene length (bp)1294
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00483 NTP_transferase Nucleotidyl transferase 3.1E-50 2 222
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 3.6E-08 245 277
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 7.4E-11 255 290
PF12804 NTP_transf_3 MobA-like NTP transferase domain 1.7E-09 3 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 1 356 0.0E+00
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 1 356 0.0E+00
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 1 356 0.0E+00
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 1 356 0.0E+00
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 1 356 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 1 356 0.0E+00
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 1 356 0.0E+00
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 1 356 0.0E+00
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 1 356 0.0E+00
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 1 356 0.0E+00
sp|Q4U3E8|MPG1_ASPFU Mannose-1-phosphate guanyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpg1 PE=2 SV=1 1 356 0.0E+00
sp|O74484|MPG1_SCHPO Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpg1 PE=2 SV=1 1 356 0.0E+00
sp|O93827|MPG1_CANAL Mannose-1-phosphate guanyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPG1 PE=1 SV=1 1 356 0.0E+00
sp|Q9P8N0|MPG1_PICAN Mannose-1-phosphate guanyltransferase OS=Pichia angusta GN=MPG1 PE=3 SV=1 1 356 0.0E+00
sp|Q6CCU3|MPG1_YARLI Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MPG1 PE=3 SV=1 1 356 0.0E+00
sp|Q6BN12|MPG1_DEBHA Mannose-1-phosphate guanyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPG1 PE=3 SV=1 1 356 0.0E+00
sp|Q70SJ2|MPG1_KLULA Mannose-1-phosphate guanyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPG1 PE=1 SV=1 1 356 6.0E-180
sp|P0CO20|MPG1_CRYNJ Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MPG1 PE=2 SV=1 1 356 7.0E-179
sp|P0CO21|MPG1_CRYNB Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MPG1 PE=3 SV=1 1 356 7.0E-179
sp|P41940|MPG1_YEAST Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSA1 PE=1 SV=2 1 356 9.0E-179
sp|Q752H4|MPG1_ASHGO Mannose-1-phosphate guanyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPG1 PE=3 SV=1 1 356 2.0E-176
sp|Q9Y725|MPG11_CANGA Mannose-1-phosphate guanyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=1 SV=1 1 356 4.0E-175
sp|Q6FRY2|MPG12_CANGA Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=3 SV=1 1 356 2.0E-169
sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 2 356 2.0E-159
sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 2 356 7.0E-159
sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 1 356 1.0E-157
sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 1 356 2.0E-157
sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 1 356 1.0E-156
sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 1 356 3.0E-156
sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 1 356 5.0E-154
sp|P0C5I2|GMPPB_PIG Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1 1 356 2.0E-153
sp|Q8BTZ7|GMPPB_MOUSE Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=1 SV=1 1 356 2.0E-153
sp|Q2YDJ9|GMPPB_BOVIN Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1 1 356 1.0E-152
sp|Q54K39|GMPPB_DICDI Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1 1 356 2.0E-150
sp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 3 OS=Oryza sativa subsp. japonica GN=Os08g0237200 PE=2 SV=1 1 356 3.0E-150
sp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os01g0847200 PE=2 SV=1 1 356 7.0E-149
sp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0268400 PE=2 SV=1 1 356 4.0E-148
sp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 1 OS=Arabidopsis thaliana GN=CYT1 PE=1 SV=1 1 356 1.0E-147
sp|Q61S97|GMPPB_CAEBR Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2 1 356 4.0E-143
sp|A3QMC8|GMPPB_CAEEL Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1 1 356 4.0E-141
sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 1 356 2.0E-138
sp|Q8H1Q7|GMPP3_ARATH Probable mannose-1-phosphate guanylyltransferase 3 OS=Arabidopsis thaliana GN=At4g30570 PE=2 SV=1 21 345 3.0E-115
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 1 346 2.0E-53
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 1 346 3.0E-53
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 1 346 7.0E-53
sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 1 346 2.0E-52
sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 1 346 3.0E-52
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 1 346 7.0E-52
sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 1 346 7.0E-52
sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 1 346 8.0E-51
sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 1 345 1.0E-50
sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 2 350 3.0E-50
sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 1 345 3.0E-49
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 1 349 6.0E-43
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 3 356 5.0E-42
sp|A4FX98|GLMU_METM5 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0513 PE=3 SV=1 1 311 3.0E-28
sp|D4GU70|AGL11_HALVD Low-salt glycan biosynthesis nucleotidyltransferase Agl11 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl11 PE=3 SV=1 1 311 7.0E-28
sp|A6VG23|GLMU_METM7 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0329 PE=3 SV=1 1 311 2.0E-27
sp|A6UP85|GLMU_METVS Bifunctional protein GlmU OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0399 PE=3 SV=1 1 311 2.0E-27
sp|A6UUQ4|GLMU_META3 Bifunctional protein GlmU OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0642 PE=3 SV=1 1 311 5.0E-25
sp|Q58501|GLMU_METJA Bifunctional protein GlmU OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmU PE=1 SV=1 1 311 3.0E-24
sp|Q6LYB5|GLMU_METMP Bifunctional protein GlmU OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1076 PE=3 SV=1 1 311 4.0E-24
sp|Q8Z5I4|RFBF_SALTI Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhi GN=rfbF PE=1 SV=1 1 234 2.0E-23
sp|A0Q3I7|GLGC_CLONN Glucose-1-phosphate adenylyltransferase OS=Clostridium novyi (strain NT) GN=glgC PE=3 SV=1 1 342 5.0E-23
sp|P26396|RFBF_SALTY Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbF PE=3 SV=1 1 234 5.0E-23
sp|Q9AGY6|HDDC_ANETH D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase OS=Aneurinibacillus thermoaerophilus GN=hddC PE=1 SV=1 1 218 1.0E-22
sp|B1YGP5|GLMU_EXIS2 Bifunctional protein GlmU OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glmU PE=3 SV=1 4 334 2.0E-19
sp|Q2G0S3|GLMU_STAA8 Bifunctional protein GlmU OS=Staphylococcus aureus (strain NCTC 8325) GN=glmU PE=3 SV=1 4 330 7.0E-19
sp|Q8NXZ7|GLMU_STAAW Bifunctional protein GlmU OS=Staphylococcus aureus (strain MW2) GN=glmU PE=3 SV=1 4 330 8.0E-19
sp|Q6GBY9|GLMU_STAAS Bifunctional protein GlmU OS=Staphylococcus aureus (strain MSSA476) GN=glmU PE=3 SV=1 4 330 8.0E-19
sp|Q5HIH6|GLMU_STAAC Bifunctional protein GlmU OS=Staphylococcus aureus (strain COL) GN=glmU PE=3 SV=1 4 330 8.0E-19
sp|Q2FJE2|GLMU_STAA3 Bifunctional protein GlmU OS=Staphylococcus aureus (strain USA300) GN=glmU PE=3 SV=1 4 330 8.0E-19
sp|P08075|RMLA_STRGR Glucose-1-phosphate thymidylyltransferase OS=Streptomyces griseus GN=strD PE=3 SV=1 1 305 2.0E-18
sp|Q2YVU6|GLMU_STAAB Bifunctional protein GlmU OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glmU PE=3 SV=2 4 330 2.0E-18
sp|Q8DPS5|GLGC_STRR6 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgC PE=3 SV=1 1 336 3.0E-18
sp|Q04KG7|GLGC_STRP2 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgC PE=3 SV=1 1 336 3.0E-18
sp|B8G1G5|GLGC_DESHD Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgC PE=3 SV=1 3 328 3.0E-18
sp|Q7A7B4|GLMU_STAAN Bifunctional protein GlmU OS=Staphylococcus aureus (strain N315) GN=glmU PE=1 SV=1 4 330 3.0E-18
sp|Q99WA4|GLMU_STAAM Bifunctional protein GlmU OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmU PE=3 SV=1 4 330 3.0E-18
sp|P37744|RMLA1_ECOLI Glucose-1-phosphate thymidylyltransferase 1 OS=Escherichia coli (strain K12) GN=rfbA PE=1 SV=2 2 259 4.0E-18
sp|B9K6N9|GLGC_THENN Glucose-1-phosphate adenylyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glgC PE=3 SV=1 3 332 4.0E-18
sp|Q24VW5|GLGC_DESHY Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glgC PE=3 SV=1 3 328 4.0E-18
sp|Q6GJH2|GLMU_STAAR Bifunctional protein GlmU OS=Staphylococcus aureus (strain MRSA252) GN=glmU PE=3 SV=1 4 330 4.0E-18
sp|Q6HPW8|GLMU_BACHK Bifunctional protein GlmU OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmU PE=3 SV=1 3 330 5.0E-18
sp|Q81J98|GLMU_BACCR Bifunctional protein GlmU OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmU PE=3 SV=1 3 330 7.0E-18
sp|B7HIL7|GLMU_BACC4 Bifunctional protein GlmU OS=Bacillus cereus (strain B4264) GN=glmU PE=3 SV=1 3 330 7.0E-18
sp|B7ISV9|GLMU_BACC2 Bifunctional protein GlmU OS=Bacillus cereus (strain G9842) GN=glmU PE=3 SV=1 3 330 7.0E-18
sp|B9IZD2|GLMU_BACCQ Bifunctional protein GlmU OS=Bacillus cereus (strain Q1) GN=glmU PE=3 SV=1 3 330 8.0E-18
sp|B7HPW0|GLMU_BACC7 Bifunctional protein GlmU OS=Bacillus cereus (strain AH187) GN=glmU PE=3 SV=1 3 330 8.0E-18
sp|Q73FF9|GLMU_BACC1 Bifunctional protein GlmU OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmU PE=3 SV=1 3 330 8.0E-18
sp|P55253|RMLA3_ECOLX Glucose-1-phosphate thymidylyltransferase OS=Escherichia coli GN=rmlA PE=3 SV=1 2 242 1.0E-17
sp|C1ESX9|GLMU_BACC3 Bifunctional protein GlmU OS=Bacillus cereus (strain 03BB102) GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|B7JK56|GLMU_BACC0 Bifunctional protein GlmU OS=Bacillus cereus (strain AH820) GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|Q81VZ1|GLMU_BACAN Bifunctional protein GlmU OS=Bacillus anthracis GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|A0R8C1|GLMU_BACAH Bifunctional protein GlmU OS=Bacillus thuringiensis (strain Al Hakam) GN=glmU PE=3 SV=2 3 330 1.0E-17
sp|C3LJ22|GLMU_BACAC Bifunctional protein GlmU OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|C3P9J5|GLMU_BACAA Bifunctional protein GlmU OS=Bacillus anthracis (strain A0248) GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|Q63HI4|GLMU_BACCZ Bifunctional protein GlmU OS=Bacillus cereus (strain ZK / E33L) GN=glmU PE=3 SV=1 3 330 1.0E-17
sp|P55254|RMLA_SALAN Glucose-1-phosphate thymidylyltransferase OS=Salmonella anatum GN=rmlA PE=3 SV=1 2 242 1.0E-17
sp|P37779|RMLA1_SHIFL Glucose-1-phosphate thymidylyltransferase 1 OS=Shigella flexneri GN=rfbA PE=3 SV=2 2 242 2.0E-17
sp|P26393|RMLA_SALTY Glucose-1-phosphate thymidylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rmlA PE=1 SV=1 2 242 2.0E-17
sp|Q3AFM0|GLMU_CARHZ Bifunctional protein GlmU OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glmU PE=3 SV=1 1 344 2.0E-17
sp|Q6KHP5|GLGC_MYCMO Glucose-1-phosphate adenylyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=glgC PE=3 SV=1 1 310 2.0E-17
sp|D4GYH1|AGLF_HALVD UTP--glucose-1-phosphate uridylyltransferase AglF OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglF PE=1 SV=1 1 242 3.0E-17
sp|B5E4N4|GLGC_STRP4 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glgC PE=3 SV=1 1 336 3.0E-17
sp|A9VN62|GLMU_BACWK Bifunctional protein GlmU OS=Bacillus weihenstephanensis (strain KBAB4) GN=glmU PE=3 SV=1 3 330 3.0E-17
sp|C1CRM1|GLGC_STRZT Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|C1CKI5|GLGC_STRZP Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|C1CEA8|GLGC_STRZJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|Q97QS7|GLGC_STRPN Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|B8ZPW3|GLGC_STRPJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|B1IBQ8|GLGC_STRPI Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glgC PE=3 SV=1 1 336 4.0E-17
sp|A4J0P6|GLMU_DESRM Bifunctional protein GlmU OS=Desulfotomaculum reducens (strain MI-1) GN=glmU PE=3 SV=1 1 344 5.0E-17
sp|Q8CXP9|GLMU_OCEIH Bifunctional protein GlmU OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmU PE=3 SV=1 3 345 5.0E-17
sp|Q97E92|GLMU_CLOAB Bifunctional protein GlmU OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmU PE=3 SV=1 3 330 7.0E-17
sp|C1C7B5|GLGC_STRP7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=glgC PE=3 SV=1 1 336 7.0E-17
sp|A3CM02|GLGC_STRSV Glucose-1-phosphate adenylyltransferase OS=Streptococcus sanguinis (strain SK36) GN=glgC PE=3 SV=1 1 336 9.0E-17
sp|Q899I9|GLMU_CLOTE Bifunctional protein GlmU OS=Clostridium tetani (strain Massachusetts / E88) GN=glmU PE=3 SV=1 3 339 1.0E-16
sp|Q8E5V7|GLGC_STRA3 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgC PE=3 SV=1 1 352 1.0E-16
sp|C0MH79|GLGC_STRS7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=glgC PE=3 SV=1 1 311 1.0E-16
sp|Q5FL67|GLGC_LACAC Glucose-1-phosphate adenylyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glgC PE=3 SV=1 1 329 2.0E-16
sp|B2IPY6|GLGC_STRPS Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=glgC PE=3 SV=1 1 336 2.0E-16
sp|Q9WY82|GLGC_THEMA Glucose-1-phosphate adenylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glgC PE=3 SV=1 3 337 2.0E-16
sp|B1L9R3|GLGC_THESQ Glucose-1-phosphate adenylyltransferase OS=Thermotoga sp. (strain RQ2) GN=glgC PE=3 SV=1 3 337 2.0E-16
sp|P39629|RMLA_BACSU Glucose-1-phosphate thymidylyltransferase OS=Bacillus subtilis (strain 168) GN=rmlA PE=1 SV=1 1 231 2.0E-16
sp|A7HN65|GLGC_FERNB Glucose-1-phosphate adenylyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glgC PE=3 SV=1 3 340 2.0E-16
sp|Q8E080|GLGC_STRA5 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgC PE=3 SV=1 1 336 3.0E-16
sp|Q3K1K4|GLGC_STRA1 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgC PE=3 SV=1 1 336 3.0E-16
sp|Q18A75|GLGC_PEPD6 Glucose-1-phosphate adenylyltransferase OS=Peptoclostridium difficile (strain 630) GN=glgC PE=3 SV=1 1 334 3.0E-16
sp|A5IKI1|GLGC_THEP1 Glucose-1-phosphate adenylyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgC PE=3 SV=1 3 343 3.0E-16
sp|Q9KDX4|GLGC_BACHD Glucose-1-phosphate adenylyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glgC PE=3 SV=1 3 293 3.0E-16
sp|Q9L385|GLGC_CLOCE Glucose-1-phosphate adenylyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glgC PE=3 SV=2 1 316 4.0E-16
sp|A3DK82|GLGC_CLOTH Glucose-1-phosphate adenylyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glgC PE=3 SV=1 3 343 5.0E-16
sp|A7GJW1|GLMU_BACCN Bifunctional protein GlmU OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glmU PE=3 SV=1 3 330 7.0E-16
sp|B2V046|GLGC_CLOBA Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glgC PE=3 SV=1 3 355 1.0E-15
sp|B7IFV2|GLGC_THEAB Glucose-1-phosphate adenylyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glgC PE=3 SV=1 3 343 1.0E-15
sp|Q0B0S9|GLMU_SYNWW Bifunctional protein GlmU OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glmU PE=3 SV=1 1 339 1.0E-15
sp|A6TJM5|GLMU_ALKMQ Bifunctional protein GlmU OS=Alkaliphilus metalliredigens (strain QYMF) GN=glmU PE=3 SV=1 1 342 1.0E-15
sp|B2TR25|GLGC_CLOBB Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glgC PE=3 SV=1 3 355 2.0E-15
sp|A6LJL4|GLGC_THEM4 Glucose-1-phosphate adenylyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glgC PE=3 SV=1 3 343 2.0E-15
sp|A8AYH2|GLGC_STRGC Glucose-1-phosphate adenylyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgC PE=3 SV=1 1 336 2.0E-15
sp|Q8DT53|GLGC_STRMU Glucose-1-phosphate adenylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgC PE=3 SV=2 1 336 3.0E-15
sp|Q890J0|GLGC_LACPL Glucose-1-phosphate adenylyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgC PE=3 SV=1 1 331 3.0E-15
sp|Q8RHM3|GLMU_FUSNN Bifunctional protein GlmU OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glmU PE=3 SV=1 1 347 3.0E-15
sp|B3W9A3|GLGC_LACCB Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain BL23) GN=glgC PE=3 SV=1 1 311 5.0E-15
sp|Q036S8|GLGC_LACC3 Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=glgC PE=3 SV=1 1 311 5.0E-15
sp|Q1DCI1|GLMU_MYXXD Bifunctional protein GlmU OS=Myxococcus xanthus (strain DK 1622) GN=glmU PE=3 SV=1 1 348 7.0E-15
sp|A5D662|GLMU_PELTS Bifunctional protein GlmU OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=glmU PE=3 SV=1 1 353 9.0E-15
sp|Q8CMT0|GLMU_STAES Bifunctional protein GlmU OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmU PE=3 SV=1 3 334 1.0E-14
sp|Q5HRQ6|GLMU_STAEQ Bifunctional protein GlmU OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmU PE=3 SV=1 3 334 1.0E-14
sp|B9DRS6|GLGC_STRU0 Glucose-1-phosphate adenylyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glgC PE=3 SV=1 1 336 1.0E-14
sp|Q1WV55|GLMU_LACS1 Bifunctional protein GlmU OS=Lactobacillus salivarius (strain UCC118) GN=glmU PE=3 SV=1 3 339 2.0E-14
sp|A6M331|GLGC_CLOB8 Glucose-1-phosphate adenylyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glgC PE=3 SV=1 3 328 2.0E-14
sp|A4IS22|GLGC_GEOTN Glucose-1-phosphate adenylyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glgC PE=3 SV=1 3 326 2.0E-14
sp|Q181B4|GLMU_PEPD6 Bifunctional protein GlmU OS=Peptoclostridium difficile (strain 630) GN=glmU PE=3 SV=1 2 334 3.0E-14
sp|P57040|RMLA_NEIMA Glucose-1-phosphate thymidylyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rmlA1 PE=3 SV=1 1 213 3.0E-14
sp|Q937Z1|GLMU_STAEP Bifunctional protein GlmU OS=Staphylococcus epidermidis GN=glmU PE=3 SV=1 3 334 3.0E-14
sp|A8F3W8|GLGC_PSELT Glucose-1-phosphate adenylyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glgC PE=3 SV=1 3 345 3.0E-14
sp|P55255|RMLA_NEIMB Glucose-1-phosphate thymidylyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rmlA1 PE=3 SV=2 1 213 4.0E-14
sp|O66863|GLMU_AQUAE Bifunctional protein GlmU OS=Aquifex aeolicus (strain VF5) GN=glmU PE=3 SV=1 1 348 4.0E-14
sp|B0KBF5|GLMU_THEP3 Bifunctional protein GlmU OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glmU PE=3 SV=1 4 351 6.0E-14
sp|A2RMB7|GLGC_LACLM Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=glgC PE=3 SV=1 1 325 1.0E-13
sp|Q0SWS5|GLGC_CLOPS Glucose-1-phosphate adenylyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=glgC PE=3 SV=1 3 316 1.0E-13
sp|Q8YQB2|GLMU_NOSS1 Bifunctional protein GlmU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glmU PE=3 SV=1 5 339 2.0E-13
sp|Q030T6|GLGC_LACLS Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=glgC PE=3 SV=1 1 325 2.0E-13
sp|O08326|GLGC_GEOSE Glucose-1-phosphate adenylyltransferase OS=Geobacillus stearothermophilus GN=glgC PE=3 SV=1 3 326 2.0E-13
sp|P61888|RMLA2_SHIFL Glucose-1-phosphate thymidylyltransferase 2 OS=Shigella flexneri GN=rffH PE=3 SV=1 1 235 2.0E-13
sp|P61887|RMLA2_ECOLI Glucose-1-phosphate thymidylyltransferase 2 OS=Escherichia coli (strain K12) GN=rffH PE=1 SV=1 1 235 2.0E-13
sp|O06486|RFBF_BACSU Probable glucose-1-phosphate cytidylyltransferase OS=Bacillus subtilis (strain 168) GN=yfnH PE=3 SV=1 1 219 3.0E-13
sp|Q8XP97|GLGC_CLOPE Glucose-1-phosphate adenylyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=glgC PE=3 SV=1 3 316 3.0E-13
sp|B1YK68|GLGC_EXIS2 Glucose-1-phosphate adenylyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glgC PE=3 SV=1 3 345 4.0E-13
sp|B7KIE0|GLMU_CYAP7 Bifunctional protein GlmU OS=Cyanothece sp. (strain PCC 7424) GN=glmU PE=3 SV=1 5 339 4.0E-13
sp|Q3MC88|GLMU_ANAVT Bifunctional protein GlmU OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glmU PE=3 SV=1 5 339 5.0E-13
sp|B0C3K5|GLMU_ACAM1 Bifunctional protein GlmU OS=Acaryochloris marina (strain MBIC 11017) GN=glmU PE=3 SV=1 5 339 6.0E-13
sp|A1ALB2|GLMU_PELPD Bifunctional protein GlmU OS=Pelobacter propionicus (strain DSM 2379) GN=glmU PE=3 SV=1 4 330 6.0E-13
sp|P30522|GLGC_BACCL Glucose-1-phosphate adenylyltransferase (Fragment) OS=Bacillus caldolyticus GN=glgC PE=3 SV=1 3 216 6.0E-13
sp|B0TBA0|GLMU_HELMI Bifunctional protein GlmU OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glmU PE=3 SV=1 4 344 8.0E-13
sp|Q03HD2|GLMU_PEDPA Bifunctional protein GlmU OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glmU PE=3 SV=1 4 329 9.0E-13
sp|A0PXK8|GLMU_CLONN Bifunctional protein GlmU OS=Clostridium novyi (strain NT) GN=glmU PE=3 SV=2 4 330 1.0E-12
sp|Q9CHN1|GLGC_LACLA Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glgC PE=3 SV=1 1 325 1.0E-12
sp|B2IU73|GLMU_NOSP7 Bifunctional protein GlmU OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=glmU PE=3 SV=1 5 339 1.0E-12
sp|Q9ZAE7|RMLA_ACTS5 Glucose-1-phosphate thymidylyltransferase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbA PE=3 SV=2 1 219 2.0E-12
sp|B2GFE2|GLMU_LACF3 Bifunctional protein GlmU OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=glmU PE=3 SV=1 3 344 2.0E-12
sp|Q97GX8|GLGC_CLOAB Glucose-1-phosphate adenylyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glgC PE=3 SV=1 3 328 2.0E-12
sp|B2UXS6|GLMU_CLOBA Bifunctional protein GlmU OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glmU PE=3 SV=1 3 330 2.0E-12
sp|P95778|RMLA_STRMU Glucose-1-phosphate thymidylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlA PE=3 SV=1 1 222 2.0E-12
sp|Q7V274|GLMU_PROMP Bifunctional protein GlmU OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glmU PE=3 SV=1 5 299 2.0E-12
sp|A7GJD9|GLMU_CLOBL Bifunctional protein GlmU OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glmU PE=3 SV=1 3 330 2.0E-12
sp|B1IH02|GLMU_CLOBK Bifunctional protein GlmU OS=Clostridium botulinum (strain Okra / Type B1) GN=glmU PE=3 SV=1 3 330 3.0E-12
sp|Q8R752|GLMU_CALS4 Bifunctional protein GlmU OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmU PE=3 SV=1 4 342 3.0E-12
sp|Q15P09|GLMU_PSEA6 Bifunctional protein GlmU OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glmU PE=3 SV=1 4 330 4.0E-12
sp|B1KTE7|GLMU_CLOBM Bifunctional protein GlmU OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glmU PE=3 SV=1 3 330 4.0E-12
sp|B0JJ82|GLMU_MICAN Bifunctional protein GlmU OS=Microcystis aeruginosa (strain NIES-843) GN=glmU PE=3 SV=2 5 339 4.0E-12
sp|C1FNF1|GLMU_CLOBJ Bifunctional protein GlmU OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glmU PE=3 SV=1 3 330 4.0E-12
sp|Q1WSM9|GLGC_LACS1 Glucose-1-phosphate adenylyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=glgC PE=3 SV=1 1 336 4.0E-12
sp|A0AF03|GLMU_LISW6 Bifunctional protein GlmU OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glmU PE=3 SV=1 3 329 5.0E-12
sp|A5I7S0|GLMU_CLOBH Bifunctional protein GlmU OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glmU PE=3 SV=1 3 330 6.0E-12
sp|A7FPK2|GLMU_CLOB1 Bifunctional protein GlmU OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glmU PE=3 SV=1 3 330 6.0E-12
sp|P55257|RMLA_YEREN Glucose-1-phosphate thymidylyltransferase OS=Yersinia enterocolitica GN=rmlA PE=3 SV=1 1 232 6.0E-12
sp|A9NH16|GLMU_ACHLI Bifunctional protein GlmU OS=Acholeplasma laidlawii (strain PG-8A) GN=glmU PE=3 SV=1 3 338 6.0E-12
sp|P37762|RMLA_NEIGO Glucose-1-phosphate thymidylyltransferase OS=Neisseria gonorrhoeae GN=rmlA PE=3 SV=1 1 213 6.0E-12
sp|A5N2Y9|GLGC_CLOK5 Glucose-1-phosphate adenylyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glgC PE=3 SV=1 1 331 7.0E-12
sp|Q65PH1|GLMU_BACLD Bifunctional protein GlmU OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmU PE=3 SV=2 3 334 7.0E-12
sp|A3N4V7|GLMU_BURP6 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 668) GN=glmU PE=3 SV=1 1 353 7.0E-12
sp|Q3JWX1|GLMU_BURP1 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 1710b) GN=glmU PE=3 SV=2 1 353 7.0E-12
sp|A3NQK0|GLMU_BURP0 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 1106a) GN=glmU PE=3 SV=1 1 353 7.0E-12
sp|A1V7Z3|GLMU_BURMS Bifunctional protein GlmU OS=Burkholderia mallei (strain SAVP1) GN=glmU PE=3 SV=1 1 353 7.0E-12
sp|Q62EP0|GLMU_BURMA Bifunctional protein GlmU OS=Burkholderia mallei (strain ATCC 23344) GN=glmU PE=3 SV=1 1 353 7.0E-12
sp|A3MND6|GLMU_BURM7 Bifunctional protein GlmU OS=Burkholderia mallei (strain NCTC 10247) GN=glmU PE=3 SV=1 1 353 7.0E-12
sp|Q8ET56|GLGC_OCEIH Glucose-1-phosphate adenylyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glgC PE=3 SV=1 3 322 7.0E-12
sp|Q63Y75|GLMU_BURPS Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain K96243) GN=glmU PE=3 SV=1 1 353 8.0E-12
sp|Q65FS5|GLGC_BACLD Glucose-1-phosphate adenylyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgC PE=3 SV=1 3 321 9.0E-12
sp|Q8Y304|GLMU_RALSO Bifunctional protein GlmU OS=Ralstonia solanacearum (strain GMI1000) GN=glmU PE=3 SV=1 1 348 1.0E-11
sp|Q97R46|GLMU_STRPN Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmU PE=1 SV=1 4 339 1.0E-11
sp|Q0SQ61|GLMU_CLOPS Bifunctional protein GlmU OS=Clostridium perfringens (strain SM101 / Type A) GN=glmU PE=3 SV=1 3 334 1.0E-11
sp|C4Z4L8|GLGC_EUBE2 Glucose-1-phosphate adenylyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glgC PE=3 SV=1 1 332 1.0E-11
sp|Q8DSX2|GLMU_STRMU Bifunctional protein GlmU OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmU PE=3 SV=1 3 339 1.0E-11
sp|C4KZV1|GLMU_EXISA Bifunctional protein GlmU OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=glmU PE=3 SV=1 4 330 1.0E-11
sp|Q1B4S9|GLGC_MYCSS Glucose-1-phosphate adenylyltransferase OS=Mycobacterium sp. (strain MCS) GN=glgC PE=3 SV=1 3 311 1.0E-11
sp|Q6AF21|GLGC_LEIXX Glucose-1-phosphate adenylyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgC PE=3 SV=1 3 329 2.0E-11
sp|Q9KLP4|GLGC2_VIBCH Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glgC2 PE=3 SV=1 3 312 2.0E-11
sp|B8DUN4|GLGC_BIFA0 Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glgC PE=3 SV=1 4 329 2.0E-11
sp|P9WN43|GLGC_MYCTU Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgC PE=1 SV=1 3 311 2.0E-11
sp|P9WN42|GLGC_MYCTO Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgC PE=3 SV=1 3 311 2.0E-11
sp|A5U1R1|GLGC_MYCTA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glgC PE=3 SV=1 3 311 2.0E-11
sp|C1AMK7|GLGC_MYCBT Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=glgC PE=3 SV=1 3 311 2.0E-11
sp|A1KI01|GLGC_MYCBP Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glgC PE=3 SV=1 3 311 2.0E-11
sp|P64242|GLGC_MYCBO Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgC PE=3 SV=1 3 311 2.0E-11
sp|Q88Z86|GLMU_LACPL Bifunctional protein GlmU OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmU PE=3 SV=1 3 334 2.0E-11
sp|Q8DYE6|GLMU_STRA5 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmU PE=3 SV=1 4 339 2.0E-11
sp|Q3JZY6|GLMU_STRA1 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glmU PE=3 SV=1 4 339 2.0E-11
sp|B9DLD6|GLMU_STACT Bifunctional protein GlmU OS=Staphylococcus carnosus (strain TM300) GN=glmU PE=3 SV=1 3 334 2.0E-11
sp|Q8DLT5|GLMU_THEEB Bifunctional protein GlmU OS=Thermosynechococcus elongatus (strain BP-1) GN=glmU PE=3 SV=2 5 330 2.0E-11
sp|Q0TMG3|GLMU_CLOP1 Bifunctional protein GlmU OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glmU PE=3 SV=1 3 334 3.0E-11
sp|C3KWA1|GLMU_CLOB6 Bifunctional protein GlmU OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glmU PE=3 SV=1 3 330 3.0E-11
sp|Q2T1V2|GLMU_BURTA Bifunctional protein GlmU OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glmU PE=3 SV=2 1 348 3.0E-11
sp|P55464|RMLA_RHISN Probable glucose-1-phosphate thymidylyltransferase OS=Rhizobium sp. (strain NGR234) GN=rmlA PE=3 SV=1 1 265 3.0E-11
sp|Q8E409|GLMU_STRA3 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmU PE=3 SV=1 4 339 4.0E-11
sp|C1KYD1|GLMU_LISMC Bifunctional protein GlmU OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glmU PE=3 SV=1 3 329 4.0E-11
sp|Q8U8L5|GLGC_AGRFC Glucose-1-phosphate adenylyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glgC PE=3 SV=1 3 321 4.0E-11
sp|P14192|GLMU_BACSU Bifunctional protein GlmU OS=Bacillus subtilis (strain 168) GN=glmU PE=3 SV=1 3 330 4.0E-11
sp|Q73WU6|GLGC_MYCPA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glgC PE=3 SV=1 3 311 5.0E-11
sp|A2BVS4|GLMU_PROM5 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9515) GN=glmU PE=3 SV=1 5 291 5.0E-11
sp|Q724L5|GLMU_LISMF Bifunctional protein GlmU OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmU PE=3 SV=1 3 329 6.0E-11
sp|P39669|GLGC_RHIRD Glucose-1-phosphate adenylyltransferase OS=Rhizobium radiobacter GN=glgC PE=1 SV=1 3 321 6.0E-11
sp|Q8XHJ3|GLMU_CLOPE Bifunctional protein GlmU OS=Clostridium perfringens (strain 13 / Type A) GN=glmU PE=3 SV=1 3 334 6.0E-11
sp|A0KB52|GLMU_BURCH Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain HI2424) GN=glmU PE=3 SV=1 1 348 6.0E-11
sp|Q1BSY8|GLMU_BURCA Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain AU 1054) GN=glmU PE=3 SV=1 1 348 6.0E-11
sp|Q92F69|GLMU_LISIN Bifunctional protein GlmU OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glmU PE=3 SV=1 3 329 7.0E-11
sp|Q49V08|GLMU_STAS1 Bifunctional protein GlmU OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glmU PE=3 SV=1 3 351 7.0E-11
sp|C1CRR4|GLMU_STRZT Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glmU PE=3 SV=1 4 339 9.0E-11
sp|Q1IWX3|GLMU_DEIGD Bifunctional protein GlmU OS=Deinococcus geothermalis (strain DSM 11300) GN=glmU PE=3 SV=1 4 330 1.0E-10
sp|C1C6W6|GLMU_STRP7 Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain 70585) GN=glmU PE=3 SV=1 4 339 1.0E-10
sp|B9L1J9|GLGC_THERP Glucose-1-phosphate adenylyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glgC PE=3 SV=1 4 337 1.0E-10
sp|B1IBE8|GLMU_STRPI Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glmU PE=3 SV=1 4 339 1.0E-10
sp|C1CDY3|GLMU_STRZJ Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain JJA) GN=glmU PE=3 SV=1 4 339 2.0E-10
sp|Q55504|GLMU_SYNY3 Bifunctional protein GlmU OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glmU PE=3 SV=1 5 339 2.0E-10
sp|B7GSX2|GLMU_BIFLS Bifunctional protein GlmU OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=glmU PE=3 SV=1 4 344 2.0E-10
sp|B2T6U5|GLMU_BURPP Bifunctional protein GlmU OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=glmU PE=3 SV=1 1 348 2.0E-10
sp|Q9L9E6|NOVV_STRNV Glucose-1-phosphate thymidylyltransferase OS=Streptomyces niveus GN=novV PE=3 SV=1 1 213 2.0E-10
sp|B8DGM7|GLMU_LISMH Bifunctional protein GlmU OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=glmU PE=3 SV=1 3 342 2.0E-10
sp|B2G5J5|GLMU_LACRJ Bifunctional protein GlmU OS=Lactobacillus reuteri (strain JCM 1112) GN=glmU PE=3 SV=1 3 329 2.0E-10
sp|A5VI16|GLMU_LACRD Bifunctional protein GlmU OS=Lactobacillus reuteri (strain DSM 20016) GN=glmU PE=3 SV=1 3 329 2.0E-10
sp|Q8YAD4|GLMU_LISMO Bifunctional protein GlmU OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmU PE=3 SV=1 3 329 3.0E-10
sp|Q8DQ18|GLMU_STRR6 Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmU PE=1 SV=2 4 339 3.0E-10
sp|Q04KU2|GLMU_STRP2 Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glmU PE=3 SV=1 4 339 3.0E-10
sp|A7Z0H3|GLMU_BACMF Bifunctional protein GlmU OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glmU PE=3 SV=1 3 330 3.0E-10
sp|Q9EUT6|GLGC_RHITR Glucose-1-phosphate adenylyltransferase OS=Rhizobium tropici GN=glgC PE=3 SV=1 3 321 3.0E-10
sp|A1TDM8|GLGC_MYCVP Glucose-1-phosphate adenylyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glgC PE=3 SV=1 3 311 4.0E-10
sp|B9JAA3|GLGC_AGRRK Glucose-1-phosphate adenylyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=glgC PE=3 SV=1 3 321 4.0E-10
sp|Q839U1|GLMU_ENTFA Bifunctional protein GlmU OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=glmU PE=3 SV=1 4 339 5.0E-10
sp|A3DIP9|GLMU_CLOTH Bifunctional protein GlmU OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glmU PE=3 SV=2 1 330 5.0E-10
sp|Q2K486|GLGC_RHIEC Glucose-1-phosphate adenylyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glgC PE=3 SV=1 3 321 5.0E-10
sp|B2UD47|GLMU_RALPJ Bifunctional protein GlmU OS=Ralstonia pickettii (strain 12J) GN=glmU PE=3 SV=1 1 348 5.0E-10
sp|B3Q9C1|GLGC_RHOPT Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=glgC PE=3 SV=1 3 321 5.0E-10
sp|Q6NCT8|GLGC_RHOPA Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glgC PE=3 SV=1 3 321 6.0E-10
sp|C1A2N3|GLGC_RHOE4 Glucose-1-phosphate adenylyltransferase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=glgC PE=3 SV=1 3 311 6.0E-10
sp|Q5L3V0|GLMU_GEOKA Bifunctional protein GlmU OS=Geobacillus kaustophilus (strain HTA426) GN=glmU PE=3 SV=1 3 353 6.0E-10
sp|Q5YQG3|GLGC_NOCFA Glucose-1-phosphate adenylyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=glgC PE=3 SV=1 3 311 6.0E-10
sp|A4VWR1|GLMU_STRSY Bifunctional protein GlmU OS=Streptococcus suis (strain 05ZYH33) GN=glmU PE=3 SV=2 4 353 7.0E-10
sp|A4W313|GLMU_STRS2 Bifunctional protein GlmU OS=Streptococcus suis (strain 98HAH33) GN=glmU PE=3 SV=2 4 353 7.0E-10
sp|Q92M13|GLGC_RHIME Glucose-1-phosphate adenylyltransferase OS=Rhizobium meliloti (strain 1021) GN=glgC PE=3 SV=1 3 321 8.0E-10
sp|A4J4I2|GLGC_DESRM Glucose-1-phosphate adenylyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glgC PE=3 SV=1 3 310 8.0E-10
sp|A1R6L8|GLGC_ARTAT Glucose-1-phosphate adenylyltransferase OS=Arthrobacter aurescens (strain TC1) GN=glgC PE=3 SV=1 3 307 9.0E-10
sp|B4E935|GLMU_BURCJ Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=glmU PE=3 SV=1 1 348 1.0E-09
sp|B5E4A8|GLMU_STRP4 Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glmU PE=3 SV=1 4 339 1.0E-09
sp|Q0S3Y4|GLGC_RHOJR Glucose-1-phosphate adenylyltransferase OS=Rhodococcus jostii (strain RHA1) GN=glgC PE=3 SV=1 3 311 1.0E-09
sp|C5CFS2|GLMU_KOSOT Bifunctional protein GlmU OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glmU PE=3 SV=1 1 339 1.0E-09
sp|C1AZL1|GLGC_RHOOB Glucose-1-phosphate adenylyltransferase OS=Rhodococcus opacus (strain B4) GN=glgC PE=3 SV=1 3 311 1.0E-09
sp|P39122|GLGC_BACSU Glucose-1-phosphate adenylyltransferase OS=Bacillus subtilis (strain 168) GN=glgC PE=2 SV=1 3 321 1.0E-09
sp|C3MIS7|GLGC_RHISN Glucose-1-phosphate adenylyltransferase OS=Rhizobium sp. (strain NGR234) GN=glgC PE=3 SV=1 3 321 1.0E-09
sp|Q21BQ2|GLGC_RHOPB Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=glgC PE=3 SV=1 3 321 1.0E-09
sp|Q7NA96|GLMU_PHOLL Bifunctional protein GlmU OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glmU PE=3 SV=1 4 351 1.0E-09
sp|A3CPC4|GLMU_STRSV Bifunctional protein GlmU OS=Streptococcus sanguinis (strain SK36) GN=glmU PE=3 SV=1 3 339 1.0E-09
sp|B2HS55|GLGC_MYCMM Glucose-1-phosphate adenylyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=glgC PE=3 SV=1 3 311 1.0E-09
sp|Q6ADP6|GLMU_LEIXX Bifunctional protein GlmU OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmU PE=3 SV=2 4 342 1.0E-09
sp|Q8G5P1|GLMU_BIFLO Bifunctional protein GlmU OS=Bifidobacterium longum (strain NCC 2705) GN=glmU PE=3 SV=1 4 344 2.0E-09
sp|B8HXB5|GLMU_CYAP4 Bifunctional protein GlmU OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=glmU PE=3 SV=1 5 339 2.0E-09
sp|B8D6U4|GLMU_BUCAT Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|P57139|GLMU_BUCAI Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|B8D8J0|GLMU_BUCA5 Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|B3Q000|GLGC_RHIE6 Glucose-1-phosphate adenylyltransferase OS=Rhizobium etli (strain CIAT 652) GN=glgC PE=3 SV=1 3 321 2.0E-09
sp|A0PVW7|GLGC_MYCUA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=glgC PE=3 SV=1 3 311 2.0E-09
sp|Q1B431|GLMU_MYCSS Bifunctional protein GlmU OS=Mycobacterium sp. (strain MCS) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|A1UL17|GLMU_MYCSK Bifunctional protein GlmU OS=Mycobacterium sp. (strain KMS) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|A3Q5G5|GLMU_MYCSJ Bifunctional protein GlmU OS=Mycobacterium sp. (strain JLS) GN=glmU PE=3 SV=1 4 351 2.0E-09
sp|A8AY88|GLMU_STRGC Bifunctional protein GlmU OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glmU PE=3 SV=1 4 339 2.0E-09
sp|A5ILV3|GLMU_THEP1 Bifunctional protein GlmU OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glmU PE=3 SV=1 1 339 2.0E-09
sp|Q87HX3|GLGC2_VIBPA Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glgC2 PE=3 SV=1 3 321 2.0E-09
sp|P9WH13|RMLA_MYCTU Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlA PE=1 SV=1 1 242 2.0E-09
sp|P9WH12|RMLA_MYCTO Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlA PE=3 SV=1 1 242 2.0E-09
sp|P0C7J4|RMLA_XANCP Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rmlA PE=3 SV=1 2 172 2.0E-09
sp|B0RVK9|RMLA_XANCB Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rmlA PE=3 SV=1 2 172 2.0E-09
sp|Q8NRU8|GLMU_CORGL Bifunctional protein GlmU OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmU PE=3 SV=1 4 342 2.0E-09
sp|Q8FQV1|GLMU_COREF Bifunctional protein GlmU OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glmU PE=3 SV=2 6 340 3.0E-09
sp|Q72LP1|GLMU_THET2 Bifunctional protein GlmU OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmU PE=3 SV=2 4 348 3.0E-09
sp|B1JZU8|GLMU_BURCC Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain MC0-3) GN=glmU PE=3 SV=1 1 348 3.0E-09
sp|A3PBY5|GLMU_PROM0 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9301) GN=glmU PE=3 SV=1 5 326 3.0E-09
sp|Q04C57|GLMU_LACDB Bifunctional protein GlmU OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=glmU PE=3 SV=1 4 295 3.0E-09
sp|Q1GBQ8|GLMU_LACDA Bifunctional protein GlmU OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=glmU PE=3 SV=1 4 295 3.0E-09
sp|C3PF87|GLMU_CORA7 Bifunctional protein GlmU OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=glmU PE=3 SV=1 4 336 3.0E-09
sp|B1LBD9|GLMU_THESQ Bifunctional protein GlmU OS=Thermotoga sp. (strain RQ2) GN=glmU PE=3 SV=1 1 339 4.0E-09
sp|Q5SLA8|GLMU_THET8 Bifunctional protein GlmU OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmU PE=3 SV=2 4 348 4.0E-09
sp|Q6GDU6|GTAB_STAAR UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=gtaB PE=3 SV=1 2 225 4.0E-09
sp|Q39C92|GLMU_BURL3 Bifunctional protein GlmU OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=glmU PE=3 SV=1 1 348 4.0E-09
sp|Q2YW63|GTAB_STAAB UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gtaB PE=3 SV=1 2 225 4.0E-09
sp|Q03T39|GLMU_LACBA Bifunctional protein GlmU OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=glmU PE=3 SV=1 4 304 4.0E-09
sp|A0QPF9|RMLA_MYCS2 Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlA PE=1 SV=1 1 176 5.0E-09
sp|Q7A3J9|GTAB_STAAN UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain N315) GN=gtaB PE=1 SV=1 2 225 7.0E-09
sp|Q99RD4|GTAB_STAAM UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gtaB PE=3 SV=1 2 225 7.0E-09
sp|Q5HD54|GTAB_STAAC UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain COL) GN=gtaB PE=3 SV=1 2 225 7.0E-09
sp|Q2G1T6|GTAB_STAA8 UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=gtaB PE=1 SV=2 2 225 7.0E-09
sp|Q2FE05|GTAB_STAA3 UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain USA300) GN=gtaB PE=3 SV=2 2 225 7.0E-09
sp|A4IJC6|GLMU_GEOTN Bifunctional protein GlmU OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glmU PE=3 SV=1 4 353 7.0E-09
sp|Q8NUU9|GTAB_STAAW UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MW2) GN=gtaB PE=3 SV=1 2 225 8.0E-09
sp|Q6G6H5|GTAB_STAAS UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=gtaB PE=3 SV=1 2 225 8.0E-09
sp|B3DSP5|GLMU_BIFLD Bifunctional protein GlmU OS=Bifidobacterium longum (strain DJO10A) GN=glmU PE=3 SV=1 4 344 8.0E-09
sp|B9DRD5|GLMU_STRU0 Bifunctional protein GlmU OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glmU PE=3 SV=1 3 340 9.0E-09
sp|A6TF49|GLGC_KLEP7 Glucose-1-phosphate adenylyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glgC PE=3 SV=1 3 290 1.0E-08
sp|Q5FMG0|GLMU_LACAC Bifunctional protein GlmU OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glmU PE=3 SV=1 4 329 1.0E-08
sp|Q9X1W4|GLMU_THEMA Bifunctional protein GlmU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmU PE=3 SV=1 1 339 1.0E-08
sp|A4T8X4|GLGC_MYCGI Glucose-1-phosphate adenylyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=glgC PE=3 SV=1 3 311 1.0E-08
sp|B5YIR0|GLGC_THEYD Glucose-1-phosphate adenylyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glgC PE=3 SV=1 3 321 1.0E-08
sp|Q8CR67|GTAB_STAES UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gtaB PE=3 SV=2 2 225 1.0E-08
sp|Q5HLD1|GTAB_STAEQ UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gtaB PE=3 SV=1 2 225 1.0E-08
sp|A4QCS3|GLMU_CORGB Bifunctional protein GlmU OS=Corynebacterium glutamicum (strain R) GN=glmU PE=3 SV=1 4 342 2.0E-08
sp|B1MLL3|GLGC_MYCA9 Glucose-1-phosphate adenylyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=glgC PE=3 SV=1 3 307 2.0E-08
sp|Q476S2|GLMU_CUPPJ Bifunctional protein GlmU OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=glmU PE=3 SV=1 1 348 2.0E-08
sp|Q816G7|GLGC_BACCR Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgC PE=3 SV=1 3 305 3.0E-08
sp|C4LHU9|GLGC_CORK4 Glucose-1-phosphate adenylyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=glgC PE=3 SV=1 4 311 4.0E-08
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 1 353 4.0E-08
sp|B5YHS4|GLMU_THEYD Bifunctional protein GlmU OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glmU PE=3 SV=1 1 339 4.0E-08
sp|Q07TH7|GLGC_RHOP5 Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=glgC PE=3 SV=1 3 321 5.0E-08
sp|Q6CYJ8|GLMU_PECAS Bifunctional protein GlmU OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmU PE=3 SV=1 1 339 5.0E-08
sp|Q5M0U2|GLMU_STRT1 Bifunctional protein GlmU OS=Streptococcus thermophilus (strain CNRZ 1066) GN=glmU PE=3 SV=1 3 339 6.0E-08
sp|B4RS18|GLGC_ALTMD Glucose-1-phosphate adenylyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glgC PE=3 SV=1 3 218 6.0E-08
sp|A9VM89|GLGC_BACWK Glucose-1-phosphate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgC PE=3 SV=1 3 305 7.0E-08
sp|Q39ZH2|GLMU_GEOMG Bifunctional protein GlmU OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glmU PE=3 SV=1 1 356 7.0E-08
sp|Q03LQ1|GLMU_STRTD Bifunctional protein GlmU OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=glmU PE=3 SV=1 3 339 7.0E-08
sp|B9J2G7|GLGC_BACCQ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=glgC PE=3 SV=1 3 345 7.0E-08
sp|Q9ZFN4|GLGC_RHORU Glucose-1-phosphate adenylyltransferase OS=Rhodospirillum rubrum GN=glgC PE=3 SV=2 3 221 9.0E-08
sp|Q2RS49|GLGC_RHORT Glucose-1-phosphate adenylyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glgC PE=3 SV=1 3 221 9.0E-08
sp|A7MGF4|GLGC_CROS8 Glucose-1-phosphate adenylyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glgC PE=3 SV=1 3 290 1.0E-07
sp|Q9CK29|GLMU_PASMU Bifunctional protein GlmU OS=Pasteurella multocida (strain Pm70) GN=glmU PE=3 SV=1 4 351 1.0E-07
sp|Q72YJ4|GLGC_BACC1 Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgC PE=3 SV=1 3 305 1.0E-07
sp|Q13EA6|GLGC_RHOPS Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=glgC PE=3 SV=2 3 321 1.0E-07
sp|B0UW09|GLMU_HISS2 Bifunctional protein GlmU OS=Histophilus somni (strain 2336) GN=glmU PE=3 SV=2 4 330 1.0E-07
sp|Q6HC16|GLGC_BACHK Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgC PE=3 SV=1 3 305 1.0E-07
sp|Q632H2|GLGC_BACCZ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glgC PE=3 SV=1 3 305 1.0E-07
sp|Q81K83|GLGC_BACAN Glucose-1-phosphate adenylyltransferase OS=Bacillus anthracis GN=glgC PE=3 SV=1 3 305 1.0E-07
sp|Q5M5C8|GLMU_STRT2 Bifunctional protein GlmU OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=glmU PE=3 SV=1 3 339 1.0E-07
sp|Q2J307|GLGC_RHOP2 Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=glgC PE=3 SV=2 3 321 2.0E-07
sp|A0RK86|GLGC_BACAH Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=glgC PE=3 SV=1 3 305 2.0E-07
sp|Q7MEE9|GLGC2_VIBVY Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio vulnificus (strain YJ016) GN=glgC2 PE=3 SV=1 4 293 2.0E-07
sp|B1XLT6|GLMU_SYNP2 Bifunctional protein GlmU OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=glmU PE=3 SV=1 5 339 2.0E-07
sp|Q05852|GTAB_BACSU UTP--glucose-1-phosphate uridylyltransferase OS=Bacillus subtilis (strain 168) GN=gtaB PE=1 SV=1 2 247 2.0E-07
sp|C6DJH5|GLMU_PECCP Bifunctional protein GlmU OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glmU PE=3 SV=1 1 339 2.0E-07
sp|A7GUA0|GLGC_BACCN Glucose-1-phosphate adenylyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgC PE=3 SV=1 3 305 2.0E-07
sp|Q6AA20|GLGC_PROAC Glucose-1-phosphate adenylyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glgC PE=3 SV=1 4 176 2.0E-07
sp|Q49VP4|GTAB2_STAS1 UTP--glucose-1-phosphate uridylyltransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gtaB2 PE=3 SV=1 2 225 2.0E-07
sp|C4K351|GLMU_HAMD5 Bifunctional protein GlmU OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=glmU PE=3 SV=1 1 339 2.0E-07
sp|A8YX58|GLMU_LACH4 Bifunctional protein GlmU OS=Lactobacillus helveticus (strain DPC 4571) GN=glmU PE=3 SV=1 4 329 2.0E-07
sp|Q0I1G0|GLMU_HAES1 Bifunctional protein GlmU OS=Haemophilus somnus (strain 129Pt) GN=glmU PE=3 SV=1 4 351 3.0E-07
sp|Q60CR2|GLMU_METCA Bifunctional protein GlmU OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glmU PE=3 SV=1 4 335 3.0E-07
sp|A1A1R9|GLMU_BIFAA Bifunctional protein GlmU OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=glmU PE=3 SV=1 9 351 3.0E-07
sp|Q9I291|GALU_PSEAE UTP--glucose-1-phosphate uridylyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=galU PE=3 SV=1 2 234 3.0E-07
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 122 3.0E-07
sp|Q58730|Y1334_METJA Putative UTP--glucose-1-phosphate uridylyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1334 PE=3 SV=1 2 183 3.0E-07
sp|B3E8Z1|GLGC_GEOLS Glucose-1-phosphate adenylyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glgC PE=3 SV=1 3 321 3.0E-07
sp|Q0BPL4|GLGC_GRABC Glucose-1-phosphate adenylyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=glgC PE=3 SV=2 5 321 4.0E-07
sp|B5ZQ46|GLGC_RHILW Glucose-1-phosphate adenylyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=glgC PE=3 SV=1 3 321 5.0E-07
sp|B8J9N1|GLMU_ANAD2 Bifunctional protein GlmU OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glmU PE=3 SV=1 1 348 6.0E-07
sp|Q8KA74|GLMU_BUCAP Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glmU PE=3 SV=1 4 346 6.0E-07
sp|Q1IQY5|GLMU_KORVE Bifunctional protein GlmU OS=Koribacter versatilis (strain Ellin345) GN=glmU PE=3 SV=1 5 339 6.0E-07
sp|Q31BS3|GLMU_PROM9 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9312) GN=glmU PE=3 SV=1 5 339 6.0E-07
sp|Q8D7E0|GLGC2_VIBVU Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio vulnificus (strain CMCP6) GN=glgC2 PE=3 SV=1 4 293 7.0E-07
sp|O67379|DIPPS_AQUAE Bifunctional IPC transferase and DIPP synthase OS=Aquifex aeolicus (strain VF5) GN=spsI PE=1 SV=1 3 217 7.0E-07
sp|Q2YB46|GLGC_NITMU Glucose-1-phosphate adenylyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glgC PE=3 SV=1 3 321 8.0E-07
sp|B8H8I4|GLGC_ARTCA Glucose-1-phosphate adenylyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=glgC PE=3 SV=1 3 353 9.0E-07
sp|B8J7Y5|GLGC_ANAD2 Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glgC PE=3 SV=1 3 321 9.0E-07
sp|Q4L8Y7|GTAB_STAHJ UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gtaB PE=3 SV=1 2 225 1.0E-06
sp|B4ULA3|GLGC_ANASK Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter sp. (strain K) GN=glgC PE=3 SV=1 3 321 1.0E-06
sp|Q31DM2|GLMU_THICR Bifunctional protein GlmU OS=Thiomicrospira crunogena (strain XCL-2) GN=glmU PE=3 SV=1 1 353 1.0E-06
sp|B2GHR6|GLGC_KOCRD Glucose-1-phosphate adenylyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glgC PE=3 SV=1 3 156 1.0E-06
sp|B4U648|GLMU_HYDS0 Bifunctional protein GlmU OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=glmU PE=3 SV=1 1 329 1.0E-06
sp|Q1MBS8|GLGC_RHIL3 Glucose-1-phosphate adenylyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glgC PE=3 SV=1 3 321 1.0E-06
sp|B0U595|GLMU_XYLFM Bifunctional protein GlmU OS=Xylella fastidiosa (strain M12) GN=glmU PE=3 SV=1 4 339 2.0E-06
sp|Q48447|GALF_KLEPN UTP--glucose-1-phosphate uridylyltransferase OS=Klebsiella pneumoniae GN=galF PE=3 SV=1 1 235 2.0E-06
sp|Q2IGL4|GLMU_ANADE Bifunctional protein GlmU OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glmU PE=3 SV=1 1 348 2.0E-06
sp|Q2JCE9|GLGC_FRASC Glucose-1-phosphate adenylyltransferase OS=Frankia sp. (strain CcI3) GN=glgC PE=3 SV=1 3 314 2.0E-06
sp|P0A2K7|GALF_SALTY UTP--glucose-1-phosphate uridylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galF PE=3 SV=1 1 180 2.0E-06
sp|P0A2K8|GALF_SALTI UTP--glucose-1-phosphate uridylyltransferase OS=Salmonella typhi GN=galF PE=3 SV=1 1 180 2.0E-06
sp|A8G3X7|GLMU_PROM2 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9215) GN=glmU PE=3 SV=1 5 270 2.0E-06
sp|B8DU78|GLMU_BIFA0 Bifunctional protein GlmU OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glmU PE=3 SV=1 4 178 2.0E-06
sp|Q0RH38|GLGC_FRAAA Glucose-1-phosphate adenylyltransferase OS=Frankia alni (strain ACN14a) GN=glgC PE=3 SV=1 3 314 4.0E-06
sp|A8KYU3|GLGC_FRASN Glucose-1-phosphate adenylyltransferase OS=Frankia sp. (strain EAN1pec) GN=glgC PE=3 SV=1 3 314 4.0E-06
sp|B4UGJ1|GLMU_ANASK Bifunctional protein GlmU OS=Anaeromyxobacter sp. (strain K) GN=glmU PE=3 SV=1 1 348 5.0E-06
sp|A1R4G1|GLMU_ARTAT Bifunctional protein GlmU OS=Arthrobacter aurescens (strain TC1) GN=glmU PE=3 SV=1 4 351 6.0E-06
sp|B4S0Y2|GLMU_ALTMD Bifunctional protein GlmU OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glmU PE=3 SV=1 4 330 7.0E-06
sp|B8F3K4|GLMU_HAEPS Bifunctional protein GlmU OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=glmU PE=3 SV=1 4 353 8.0E-06
sp|O31822|YNGB_BACSU Probable UTP--glucose-1-phosphate uridylyltransferase YngB OS=Bacillus subtilis (strain 168) GN=yngB PE=3 SV=1 2 237 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2181
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5983 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|943
Ophiocordyceps camponoti-floridani Ophcf2|01538
Ophiocordyceps camponoti-rufipedis Ophun1|4386
Ophiocordyceps kimflemingae Ophio5|1906
Ophiocordyceps subramaniannii Hirsu2|2701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5983
MKGLILVGGFGTRLRPLTLTLPKPLVEFGNKPMIVHQIEALVAAGVTDIVLAVNYRPEYEEKYNINIEFSVESEP
LDTAGPLKLAEKILLKDDSPFFVLNSDVICDYPFAQLLQFHKNHGDQGTIVVTKVEEPSKYGVVVHQPNHPSRID
RFVEKPVEFVGNRINAGMYIFNTSVLKRIQLRPTSIEKETFPSMVLDNQLHSFDLEGFWMDVGQPKDFLSGTCLY
LSSLTKRGSKELTPPTEPYVHGGNVLIDPSAKIGNNCRIGPNVTIGPDVVVGDGVRLQRCVLLRGSKVKDHAWVK
STIVGWNSIVGRWARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKANVDVPAIIM*
Coding >OphauG2|5983
ATGAAAGGTCTCATCCTCGTCGGCGGTTTTGGCACCCGCCTCCGCCCTCTTACCCTCACTTTGCCCAAGCCTCTG
GTCGAATTCGGCAACAAACCCATGATAGTCCACCAGATCGAGGCGCTTGTCGCTGCTGGCGTCACCGACATTGTT
CTCGCTGTCAACTATCGTCCCGAGTACGAGGAAAAATACAACATCAATATCGAGTTCTCCGTCGAATCTGAACCC
CTTGACACAGCAGGCCCCCTTAAGCTTGCTGAGAAGATACTCCTCAAGGACGACTCGCCCTTTTTTGTCCTCAAC
TCAGACGTCATCTGTGACTATCCTTTTGCCCAACTCTTGCAATTCCACAAGAACCACGGCGACCAAGGCACAATT
GTCGTGACCAAGGTCGAGGAACCTTCTAAATATGGCGTCGTTGTTCACCAGCCCAACCATCCCTCCCGCATCGAC
CGATTCGTCGAGAAGCCCGTTGAATTTGTTGGCAACCGCATAAATGCCGGCATGTACATCTTCAACACTTCTGTT
CTCAAACGCATCCAACTACGACCAACGTCGATCGAAAAAGAGACTTTTCCTTCCATGGTGCTCGACAACCAGCTG
CATTCCTTTGATCTTGAAGGCTTTTGGATGGATGTCGGCCAGCCCAAGGACTTTCTCAGCGGCACCTGCCTCTAT
CTTTCCTCTCTCACCAAGCGCGGAAGCAAGGAATTAACCCCTCCAACTGAGCCCTACGTTCACGGCGGTAATGTT
CTCATTGACCCCTCGGCCAAGATTGGTAACAATTGCCGCATTGGTCCCAACGTCACCATTGGCCCAGATGTTGTT
GTAGGAGATGGCGTCCGTCTACAACGGTGCGTCCTCTTGCGCGGCTCCAAGGTCAAGGACCACGCCTGGGTCAAG
TCGACTATTGTTGGGTGGAACAGCATCGTCGGTCGCTGGGCGCGCCTCGAAAATGTCACTGTTCTCGGCGACGAC
GTGACCATTGGAGACGAGATTTATGTCAATGGCGGCAGCGTTCTGCCTCACAAGTCCATCAAGGCCAATGTCGAC
GTGCCTGCCATCATCATGTAA
Transcript >OphauG2|5983
ATGAAAGGTCTCATCCTCGTCGGCGGTTTTGGCACCCGCCTCCGCCCTCTTACCCTCACTTTGCCCAAGCCTCTG
GTCGAATTCGGCAACAAACCCATGATAGTCCACCAGATCGAGGCGCTTGTCGCTGCTGGCGTCACCGACATTGTT
CTCGCTGTCAACTATCGTCCCGAGTACGAGGAAAAATACAACATCAATATCGAGTTCTCCGTCGAATCTGAACCC
CTTGACACAGCAGGCCCCCTTAAGCTTGCTGAGAAGATACTCCTCAAGGACGACTCGCCCTTTTTTGTCCTCAAC
TCAGACGTCATCTGTGACTATCCTTTTGCCCAACTCTTGCAATTCCACAAGAACCACGGCGACCAAGGCACAATT
GTCGTGACCAAGGTCGAGGAACCTTCTAAATATGGCGTCGTTGTTCACCAGCCCAACCATCCCTCCCGCATCGAC
CGATTCGTCGAGAAGCCCGTTGAATTTGTTGGCAACCGCATAAATGCCGGCATGTACATCTTCAACACTTCTGTT
CTCAAACGCATCCAACTACGACCAACGTCGATCGAAAAAGAGACTTTTCCTTCCATGGTGCTCGACAACCAGCTG
CATTCCTTTGATCTTGAAGGCTTTTGGATGGATGTCGGCCAGCCCAAGGACTTTCTCAGCGGCACCTGCCTCTAT
CTTTCCTCTCTCACCAAGCGCGGAAGCAAGGAATTAACCCCTCCAACTGAGCCCTACGTTCACGGCGGTAATGTT
CTCATTGACCCCTCGGCCAAGATTGGTAACAATTGCCGCATTGGTCCCAACGTCACCATTGGCCCAGATGTTGTT
GTAGGAGATGGCGTCCGTCTACAACGGTGCGTCCTCTTGCGCGGCTCCAAGGTCAAGGACCACGCCTGGGTCAAG
TCGACTATTGTTGGGTGGAACAGCATCGTCGGTCGCTGGGCGCGCCTCGAAAATGTCACTGTTCTCGGCGACGAC
GTGACCATTGGAGACGAGATTTATGTCAATGGCGGCAGCGTTCTGCCTCACAAGTCCATCAAGGCCAATGTCGAC
GTGCCTGCCATCATCATGTAA
Gene >OphauG2|5983
ATGAAAGGTGCGTCCGCTTTGCCTCGCTCTTGCCATGTGCTTGCTCACCGTTAATGCAGGTCTCATCCTCGTCGG
CGGTTTTGGCACCCGCCTCCGCCCTCTTGTACGTGGCTGAATTGTTGCTGGCGTCTGCTACCCACCTCTATGCCG
CACTGGCTCCTCAGGCTGACTGCCATGCCCTCTTCAAGACCCTCACTTTGCCCAAGCCTCTGGTCGAATTCGGCA
ACAAACCCATGATAGTCCACCAGATCGAGGCGCTTGTCGCTGCTGGCGTCACCGACATTGTTCTCGCTGTCAACT
ATCGTCCCGAGGTGATGGAAAAGTTTTTGGCCGAGGCATGTCCCCCGCCTGCTGCCCATGTTCACTCCATGGCTA
TACTGACGCGTCTCTTGCCCAGTACGAGGAAAAATACAACATCAATATCGAGTTCTCCGTCGAATCTGAACCCCT
TGACACAGCAGGCCCCCTTAAGCTTGCTGAGAAGATACTCCTCAAGGACGACTCGCCCTTTTTTGTCCTCAACTC
AGACGTCATCTGTGACTATCCTTTTGCCCAACTCTTGCAATTCCACAAGAACCACGGCGACCAAGGCACAATTGT
CGTGACCAAGGTCGAGGAACCTTCTAAATATGGCGTCGTTGTTCACCAGCCCAACCATCCCTCCCGCATCGACCG
ATTCGTCGAGAAGCCCGTTGAATTTGTTGGCAACCGCATAAATGCCGGCATGTACATCTTCAACACTTCTGTTCT
CAAACGCATCCAACTACGACCAACGTCGATCGAAAAAGAGACTTTTCCTTCCATGGTGCTCGACAACCAGCTGCA
TTCCTTTGATCTTGAAGGCTTTTGGATGGATGTCGGCCAGCCCAAGGACTTTCTCAGCGGCACCTGCCTCTATCT
TTCCTCTCTCACCAAGCGCGGAAGCAAGGAATTAACCCCTCCAACTGAGCCCTACGTTCACGGCGGTAATGTTCT
CATTGACCCCTCGGCCAAGATTGGTAACAATTGCCGCATTGGTCCCAACGTCACCATTGGCCCAGATGTTGTTGT
AGGAGATGGCGTCCGTCTACAACGGTGCGTCCTCTTGCGCGGCTCCAAGGTCAAGGACCACGCCTGGGTCAAGTC
GACTATTGTTGGGTGGAACAGCATCGTCGGTCGCTGGGCGCGCCTCGAAAATGTCACTGTTCTCGGCGACGACGT
GACCATTGGAGACGAGATTTATGTCAATGGCGGCAGCGTTCTGCCTCACAAGTCCATCAAGGCCAATGTCGACGT
GCCTGCCATCATCATGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail