Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5969
Gene name
LocationContig_581:7684..9007
Strand-
Gene length (bp)1323
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 1.0E-13 300 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S0P8|CSN4_NEUCR COP9 signalosome complex subunit 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-4 PE=1 SV=1 17 436 7.0E-134
sp|Q9C467|CSN4_EMENI COP9 signalosome complex subunit 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnD PE=1 SV=2 11 431 1.0E-100
sp|Q68FS2|CSN4_RAT COP9 signalosome complex subunit 4 OS=Rattus norvegicus GN=Cops4 PE=1 SV=1 126 427 1.0E-75
sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 126 427 1.0E-75
sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 126 427 1.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S0P8|CSN4_NEUCR COP9 signalosome complex subunit 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-4 PE=1 SV=1 17 436 7.0E-134
sp|Q9C467|CSN4_EMENI COP9 signalosome complex subunit 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnD PE=1 SV=2 11 431 1.0E-100
sp|Q68FS2|CSN4_RAT COP9 signalosome complex subunit 4 OS=Rattus norvegicus GN=Cops4 PE=1 SV=1 126 427 1.0E-75
sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 126 427 1.0E-75
sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 126 427 1.0E-75
sp|A7Y521|CSN4_PIG COP9 signalosome complex subunit 4 OS=Sus scrofa GN=COPS4 PE=2 SV=1 126 427 1.0E-75
sp|Q4R5E6|CSN4_MACFA COP9 signalosome complex subunit 4 OS=Macaca fascicularis GN=COPS4 PE=2 SV=1 126 427 1.0E-75
sp|Q9BT78|CSN4_HUMAN COP9 signalosome complex subunit 4 OS=Homo sapiens GN=COPS4 PE=1 SV=1 126 427 1.0E-75
sp|Q5R648|CSN4_PONAB COP9 signalosome complex subunit 4 OS=Pongo abelii GN=COPS4 PE=2 SV=1 126 427 2.0E-75
sp|Q6P0H6|CSN4_DANRE COP9 signalosome complex subunit 4 OS=Danio rerio GN=cops4 PE=2 SV=1 126 428 1.0E-74
sp|Q54B82|CSN4_DICDI COP9 signalosome complex subunit 4 OS=Dictyostelium discoideum GN=csn4 PE=2 SV=1 126 436 8.0E-71
sp|Q9V345|CSN4_DROME COP9 signalosome complex subunit 4 OS=Drosophila melanogaster GN=CSN4 PE=1 SV=1 126 427 2.0E-67
sp|Q8L5U0|CSN4_ARATH COP9 signalosome complex subunit 4 OS=Arabidopsis thaliana GN=CSN4 PE=1 SV=2 135 427 6.0E-63
sp|Q9N359|CSN4_CAEEL COP9 signalosome complex subunit 4 OS=Caenorhabditis elegans GN=csn-4 PE=1 SV=1 136 431 1.0E-45
sp|Q9UTM3|RPN5_SCHPO 26S proteasome regulatory subunit rpn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn501 PE=1 SV=1 131 434 2.0E-09
sp|O00232|PSD12_HUMAN 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens GN=PSMD12 PE=1 SV=3 131 390 1.0E-07
sp|Q5RBI3|PSD12_PONAB 26S proteasome non-ATPase regulatory subunit 12 OS=Pongo abelii GN=PSMD12 PE=2 SV=3 131 390 1.0E-07
sp|Q2KJ25|PSD12_BOVIN 26S proteasome non-ATPase regulatory subunit 12 OS=Bos taurus GN=PSMD12 PE=2 SV=3 131 390 7.0E-07
sp|Q9D8W5|PSD12_MOUSE 26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus GN=Psmd12 PE=1 SV=4 131 390 4.0E-06
sp|Q12250|RPN5_YEAST 26S proteasome regulatory subunit RPN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN5 PE=1 SV=3 225 434 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2980
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5969 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2295
Ophiocordyceps camponoti-floridani Ophcf2|07201
Ophiocordyceps camponoti-rufipedis Ophun1|4758
Ophiocordyceps kimflemingae Ophio5|7561
Ophiocordyceps subramaniannii Hirsu2|5101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5969
MADLLGGSGPPCTTLVDALARIDEAPTVQKAQMYEALLAALKACSTQETACKDLTSIMASIRTHALGVVALRSIL
SACLDTIESFDSQVVKMAMIPNMFALVTQPTASTSSSTASAATSSSSSSVFSDLMARMCEMLAGAHESQGEFNKA
ATTLALIPLDSSQRRVSDLERARVWVRIVRNYLEIDDTTAAESYVNKLKNIMHDVDNVELQLHFGLSQARILDAQ
RSFLSAAQRYHDISFSPAIADAERLHTLTMAVKCALLAPAGPARSRMLARLYKDERCSQLDEFGILEKMLLDRLL
TPAEVEKFAQGLQPHQLAKMADGSTVLQKAVVEHNLVGVSRLYANIQFEALGHLVDLDAIRVEEITARMIEQGRL
NGRIHQVTGVVEFERGEASGQRSNGKPEPMVGKELRQWGANVESLSEEIDNIANCLQNEFPVSNS*
Coding >OphauG2|5969
ATGGCCGACCTGCTCGGTGGCAGTGGCCCACCATGCACCACTCTTGTCGATGCCCTTGCCCGCATAGATGAGGCC
CCTACCGTGCAAAAAGCCCAAATGTATGAGGCTCTGCTGGCGGCCCTCAAGGCATGCTCGACACAGGAAACGGCG
TGCAAGGACCTCACATCCATCATGGCCTCCATCAGGACTCATGCCCTGGGCGTCGTTGCTCTTCGCTCCATTCTC
TCGGCCTGTCTCGACACCATCGAGAGCTTTGACAGTCAAGTTGTCAAGATGGCCATGATCCCAAACATGTTTGCT
CTTGTCACGCAGCCCACGGCGTCGACTTCTTCATCTACGGCTTCTGCTGCCACTTCGTCTTCGTCGTCATCCGTC
TTCTCTGACCTCATGGCTCGCATGTGCGAAATGCTCGCCGGGGCTCACGAGAGCCAAGGCGAGTTCAACAAGGCA
GCCACGACACTGGCCCTGATACCTCTGGATAGCTCTCAGCGTCGCGTCTCGGACCTGGAACGCGCCCGTGTGTGG
GTTCGGATTGTGCGCAACTATCTCGAGATTGACGATACCACGGCGGCTGAGAGCTACGTCAACAAGCTCAAGAAC
ATCATGCACGACGTGGACAATGTCGAATTGCAGCTCCATTTTGGTCTGTCACAGGCTCGCATTCTCGATGCCCAG
CGCAGCTTTCTCTCTGCCGCTCAAAGATACCACGACATCAGCTTCTCGCCCGCCATTGCTGACGCAGAGCGCCTT
CACACACTCACCATGGCGGTCAAGTGTGCGCTCCTTGCTCCCGCCGGCCCGGCACGTAGCCGCATGCTAGCTCGC
CTCTACAAAGATGAGCGTTGCTCTCAGCTCGACGAGTTTGGTATTCTTGAGAAGATGCTGCTCGACCGGCTTTTG
ACGCCCGCAGAGGTGGAAAAGTTTGCCCAAGGTTTGCAGCCTCATCAGCTGGCCAAGATGGCAGATGGGTCCACG
GTGCTGCAAAAGGCTGTCGTGGAGCATAACCTTGTCGGTGTCTCGCGACTCTACGCCAACATACAATTTGAAGCC
CTGGGCCATCTTGTTGACCTTGACGCTATTCGAGTCGAGGAGATAACGGCACGCATGATTGAACAAGGCCGTCTC
AACGGCAGGATTCACCAAGTCACTGGTGTTGTCGAATTTGAGCGCGGCGAGGCCTCGGGACAAAGGAGTAACGGC
AAGCCAGAGCCCATGGTGGGAAAGGAATTGCGCCAGTGGGGAGCAAATGTTGAAAGCCTGTCTGAAGAAATCGAC
AACATAGCCAATTGTCTGCAAAACGAATTCCCGGTAAGTAACTCTTGA
Transcript >OphauG2|5969
ATGGCCGACCTGCTCGGTGGCAGTGGCCCACCATGCACCACTCTTGTCGATGCCCTTGCCCGCATAGATGAGGCC
CCTACCGTGCAAAAAGCCCAAATGTATGAGGCTCTGCTGGCGGCCCTCAAGGCATGCTCGACACAGGAAACGGCG
TGCAAGGACCTCACATCCATCATGGCCTCCATCAGGACTCATGCCCTGGGCGTCGTTGCTCTTCGCTCCATTCTC
TCGGCCTGTCTCGACACCATCGAGAGCTTTGACAGTCAAGTTGTCAAGATGGCCATGATCCCAAACATGTTTGCT
CTTGTCACGCAGCCCACGGCGTCGACTTCTTCATCTACGGCTTCTGCTGCCACTTCGTCTTCGTCGTCATCCGTC
TTCTCTGACCTCATGGCTCGCATGTGCGAAATGCTCGCCGGGGCTCACGAGAGCCAAGGCGAGTTCAACAAGGCA
GCCACGACACTGGCCCTGATACCTCTGGATAGCTCTCAGCGTCGCGTCTCGGACCTGGAACGCGCCCGTGTGTGG
GTTCGGATTGTGCGCAACTATCTCGAGATTGACGATACCACGGCGGCTGAGAGCTACGTCAACAAGCTCAAGAAC
ATCATGCACGACGTGGACAATGTCGAATTGCAGCTCCATTTTGGTCTGTCACAGGCTCGCATTCTCGATGCCCAG
CGCAGCTTTCTCTCTGCCGCTCAAAGATACCACGACATCAGCTTCTCGCCCGCCATTGCTGACGCAGAGCGCCTT
CACACACTCACCATGGCGGTCAAGTGTGCGCTCCTTGCTCCCGCCGGCCCGGCACGTAGCCGCATGCTAGCTCGC
CTCTACAAAGATGAGCGTTGCTCTCAGCTCGACGAGTTTGGTATTCTTGAGAAGATGCTGCTCGACCGGCTTTTG
ACGCCCGCAGAGGTGGAAAAGTTTGCCCAAGGTTTGCAGCCTCATCAGCTGGCCAAGATGGCAGATGGGTCCACG
GTGCTGCAAAAGGCTGTCGTGGAGCATAACCTTGTCGGTGTCTCGCGACTCTACGCCAACATACAATTTGAAGCC
CTGGGCCATCTTGTTGACCTTGACGCTATTCGAGTCGAGGAGATAACGGCACGCATGATTGAACAAGGCCGTCTC
AACGGCAGGATTCACCAAGTCACTGGTGTTGTCGAATTTGAGCGCGGCGAGGCCTCGGGACAAAGGAGTAACGGC
AAGCCAGAGCCCATGGTGGGAAAGGAATTGCGCCAGTGGGGAGCAAATGTTGAAAGCCTGTCTGAAGAAATCGAC
AACATAGCCAATTGTCTGCAAAACGAATTCCCGGTAAGTAACTCTTGA
Gene >OphauG2|5969
ATGGCCGACCTGCTCGGTGGCAGTGGCCCACCATGCACCACTCTTGTCGATGCCCTTGCCCGCATAGATGAGGCC
CCTACCGTGCAAAAAGCCCAAATGTATGAGGCTCTGCTGGCGGCCCTCAAGGCATGCTCGACACAGGAAACGGCG
TGCAAGGACCTCACATCCATCATGGCCTCCATCAGGACTCATGCCCTGGGCGTCGTTGCTCTTCGCTCCATTCTC
TCGGCCTGTCTCGACACCATCGAGAGCTTTGACAGTCAAGTTGTCAAGATGGCCATGATCCCAAACATGTTTGCT
CTTGTCACGCAGCCCACGGCGTCGACTTCTTCATCTACGGCTTCTGCTGCCACTTCGTCTTCGTCGTCATCCGTC
TTCTCTGACCTCATGGCTCGCATGTGCGAAATGCTCGCCGGGGCTCACGAGAGCCAAGGCGAGTTCAACAAGGCA
GCCACGACACTGGCCCTGATACCTCTGGATAGCTCTCAGCGTCGCGTCTCGGACCTGGAACGCGCCCGTGTGTGG
GTTCGGATTGTGCGCAACTATCTCGAGATTGACGATACCACGGCGGCTGAGAGCTACGTCAACAAGCTCAAGAAC
ATCATGCACGACGTGGACAATGTCGAATTGCAGCTCCATTTTGGTCTGTCACAGGCTCGCATTCTCGATGCCCAG
CGCAGCTTTCTCTCTGCCGCTCAAAGATACCACGACATCAGCTTCTCGCCCGCCATTGCTGACGCAGAGCGCCTT
CACACACTCACCATGGCGGTCAAGTGTGCGCTCCTTGCTCCCGCCGGCCCGGCACGTAGCCGCATGCTAGCTCGC
CTCTACAAAGATGAGCGTTGCTCTCAGCTCGACGAGTTTGGTATTCTTGAGAAGATGCTGCTCGACCGGCTTTTG
ACGCCCGCAGAGGTGGAAAAGTTTGCCCAAGGTTTGCAGCCTCATCAGCTGGCCAAGATGGCAGATGGGTCCACG
GTGCTGCAAAAGGCTGTCGTGGAGCATAACCTTGTCGGTGTCTCGCGACTCTACGCCAACATACAATTTGAAGCC
CTGGGCCATCTTGTTGACCTTGACGCTATTCGAGTCGAGGAGATAACGGCACGCATGATTGAACAAGGCCGTCTC
AACGGCAGGATTCACCAAGTCACTGGTGTTGTCGAATTTGAGCGCGGCGAGGCCTCGGGACAAAGGAGTAACGGC
AAGCCAGAGCCCATGGTGGGAAAGGAATTGCGCCAGTGGGGAGCAAATGTTGAAAGCCTGTCTGAAGAAATCGAC
AACATAGCCAATTGTCTGCAAAACGAATTCCCGGTAAGTAACTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail