Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5961
Gene name
LocationContig_580:1376..2375
Strand+
Gene length (bp)999
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 1.3E-54 24 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56553|CGR1P_CANAL Cell growth-regulated gene 1 protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGR1 PE=3 SV=2 24 301 1.0E-25
sp|P46218|Y1674_SULAC Uncharacterized protein Saci_1674 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_1674 PE=3 SV=2 23 280 4.0E-22
sp|Q92RN9|GALAB_RHIME Putative sugar lactone lactonase OS=Rhizobium meliloti (strain 1021) GN=R00823 PE=3 SV=1 24 313 4.0E-21
sp|Q9I922|RGN_XENLA Regucalcin OS=Xenopus laevis GN=rgn PE=2 SV=1 24 280 7.0E-21
sp|Q1JUP5|ARALA_AZOBR L-arabinolactonase OS=Azospirillum brasilense GN=araB PE=1 SV=1 24 311 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56553|CGR1P_CANAL Cell growth-regulated gene 1 protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGR1 PE=3 SV=2 24 301 1.0E-25
sp|P46218|Y1674_SULAC Uncharacterized protein Saci_1674 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_1674 PE=3 SV=2 23 280 4.0E-22
sp|Q92RN9|GALAB_RHIME Putative sugar lactone lactonase OS=Rhizobium meliloti (strain 1021) GN=R00823 PE=3 SV=1 24 313 4.0E-21
sp|Q9I922|RGN_XENLA Regucalcin OS=Xenopus laevis GN=rgn PE=2 SV=1 24 280 7.0E-21
sp|Q1JUP5|ARALA_AZOBR L-arabinolactonase OS=Azospirillum brasilense GN=araB PE=1 SV=1 24 311 2.0E-20
sp|Q9TTJ5|RGN_BOVIN Regucalcin OS=Bos taurus GN=RGN PE=2 SV=1 18 311 3.0E-20
sp|Q9I923|RGN_CHICK Regucalcin OS=Gallus gallus GN=RGN PE=2 SV=1 24 311 4.0E-20
sp|O34940|YVRE_BACSU Putative sugar lactone lactonase YvrE OS=Bacillus subtilis (strain 168) GN=yvrE PE=3 SV=1 23 305 4.0E-20
sp|Q6DF62|RGN_XENTR Regucalcin OS=Xenopus tropicalis GN=rgn PE=2 SV=1 24 280 6.0E-20
sp|Q9TTJ6|RGN_RABIT Regucalcin OS=Oryctolagus cuniculus GN=RGN PE=2 SV=1 18 311 7.0E-20
sp|Q6TLF6|RGN_DANRE Regucalcin OS=Danio rerio GN=rgn PE=2 SV=1 24 311 9.0E-20
sp|Q06AA3|RGN_PIG Regucalcin OS=Sus scrofa GN=RGN PE=2 SV=1 18 311 1.0E-19
sp|Q2PFX5|RGN_MACFA Regucalcin OS=Macaca fascicularis GN=RGN PE=2 SV=1 18 311 3.0E-19
sp|Q64374|RGN_MOUSE Regucalcin OS=Mus musculus GN=Rgn PE=1 SV=1 18 311 5.0E-19
sp|Q5R837|RGN_PONAB Regucalcin OS=Pongo abelii GN=RGN PE=2 SV=1 18 311 5.0E-19
sp|Q03336|RGN_RAT Regucalcin OS=Rattus norvegicus GN=Rgn PE=1 SV=3 18 311 1.0E-18
sp|Q15493|RGN_HUMAN Regucalcin OS=Homo sapiens GN=RGN PE=1 SV=1 18 311 2.0E-18
sp|P38235|YBQ3_YEAST Uncharacterized protein YBR053C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR053C PE=1 SV=1 82 299 7.0E-12
sp|Q4L9R6|DRP35_STAHJ Lactonase drp35 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=drp35 PE=3 SV=1 113 312 3.0E-08
sp|Q8CQ97|DRP35_STAES Lactonase drp35 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=drp35 PE=3 SV=1 115 292 2.0E-06
sp|Q9S0S3|DRP35_STAAU Lactonase drp35 OS=Staphylococcus aureus GN=drp35 PE=2 SV=2 121 262 3.0E-06
sp|Q6GDB6|DRP35_STAAR Lactonase drp35 OS=Staphylococcus aureus (strain MRSA252) GN=drp35 PE=3 SV=1 121 262 3.0E-06
sp|Q4A0D3|DRP35_STAS1 Lactonase drp35 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=drp35 PE=3 SV=1 121 262 4.0E-06
sp|Q7A338|DRP35_STAAN Lactonase drp35 OS=Staphylococcus aureus (strain N315) GN=drp35 PE=1 SV=1 121 262 6.0E-06
sp|Q99QV3|DRP35_STAAM Lactonase drp35 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=drp35 PE=1 SV=1 121 262 6.0E-06
sp|Q5HCK9|DRP35_STAAC Lactonase drp35 OS=Staphylococcus aureus (strain COL) GN=drp35 PE=3 SV=2 121 262 6.0E-06
sp|Q2FUS8|DRP35_STAA8 Lactonase drp35 OS=Staphylococcus aureus (strain NCTC 8325) GN=drp35 PE=3 SV=2 121 262 6.0E-06
sp|Q2FDH3|DRP35_STAA3 Lactonase drp35 OS=Staphylococcus aureus (strain USA300) GN=drp35 PE=3 SV=2 121 262 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7168
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5961 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1343

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5961
MTMAHAAVAQWNVTQPWLEPHCALGEGPFYESQTHSIRFVDIKKRQLLTASLHDGPGSLHVLQVDASSPSVTADI
QGVDPREQIAVGVKQGLGVLDRRSGHCRLLSRFAAGGEDNARLRSNDGAVDCNGRFWLGSMTDFSFGQVQPEGSL
FRFSAMAAADVAVANVAIPNSVGWSPDGTIMYFADSRARQIRSWDYDAAASSAASALRNPQVLYQHNGPGEPDGF
RVDVDGNIWTAVYGEGRVLKIDSGGRVAGVVTLPTRNITCVQFAGTELIITSAADDDAAADAPSRRYGGAVFRVD
VGTTGLDLFKFRM*
Coding >OphauG2|5961
ATGACAATGGCCCACGCAGCAGTGGCTCAGTGGAACGTCACGCAGCCGTGGCTGGAGCCCCATTGTGCCCTGGGA
GAGGGGCCCTTTTACGAGTCACAGACTCACTCAATTCGCTTTGTCGACATCAAAAAACGCCAACTGCTCACGGCG
TCGCTCCATGATGGACCCGGGTCGCTGCATGTGCTACAAGTCGACGCTTCTAGTCCAAGTGTCACTGCAGACATT
CAAGGTGTTGACCCGCGCGAGCAAATCGCCGTTGGCGTCAAGCAAGGCCTCGGAGTGCTGGACCGCCGCTCAGGA
CACTGCCGCTTGCTGTCTCGTTTTGCAGCAGGCGGGGAAGACAATGCGCGGCTGAGAAGCAACGACGGCGCTGTT
GATTGCAATGGGCGCTTCTGGCTCGGCAGCATGACGGACTTTTCCTTTGGACAAGTTCAACCCGAGGGATCACTG
TTCCGCTTCTCCGCCATGGCCGCGGCAGATGTTGCTGTGGCCAATGTTGCGATTCCAAACTCGGTTGGCTGGTCG
CCTGATGGCACCATCATGTACTTTGCCGACTCGCGCGCCCGCCAGATCCGTTCATGGGACTACGATGCTGCAGCC
TCGTCGGCTGCTTCTGCGCTACGGAACCCGCAGGTCTTGTACCAGCATAATGGGCCTGGCGAGCCTGATGGCTTC
CGCGTCGACGTGGACGGTAACATTTGGACTGCCGTGTATGGCGAAGGCCGGGTGCTTAAGATTGACAGTGGCGGC
CGCGTCGCTGGAGTGGTGACGCTGCCAACACGCAACATCACCTGCGTCCAATTTGCAGGCACCGAGCTTATCATC
ACATCGGCTGCTGACGACGACGCCGCCGCCGATGCCCCAAGCCGGCGCTACGGAGGCGCCGTCTTCCGGGTCGAC
GTCGGCACCACAGGCCTTGATCTGTTCAAGTTTCGCATGTGA
Transcript >OphauG2|5961
ATGACAATGGCCCACGCAGCAGTGGCTCAGTGGAACGTCACGCAGCCGTGGCTGGAGCCCCATTGTGCCCTGGGA
GAGGGGCCCTTTTACGAGTCACAGACTCACTCAATTCGCTTTGTCGACATCAAAAAACGCCAACTGCTCACGGCG
TCGCTCCATGATGGACCCGGGTCGCTGCATGTGCTACAAGTCGACGCTTCTAGTCCAAGTGTCACTGCAGACATT
CAAGGTGTTGACCCGCGCGAGCAAATCGCCGTTGGCGTCAAGCAAGGCCTCGGAGTGCTGGACCGCCGCTCAGGA
CACTGCCGCTTGCTGTCTCGTTTTGCAGCAGGCGGGGAAGACAATGCGCGGCTGAGAAGCAACGACGGCGCTGTT
GATTGCAATGGGCGCTTCTGGCTCGGCAGCATGACGGACTTTTCCTTTGGACAAGTTCAACCCGAGGGATCACTG
TTCCGCTTCTCCGCCATGGCCGCGGCAGATGTTGCTGTGGCCAATGTTGCGATTCCAAACTCGGTTGGCTGGTCG
CCTGATGGCACCATCATGTACTTTGCCGACTCGCGCGCCCGCCAGATCCGTTCATGGGACTACGATGCTGCAGCC
TCGTCGGCTGCTTCTGCGCTACGGAACCCGCAGGTCTTGTACCAGCATAATGGGCCTGGCGAGCCTGATGGCTTC
CGCGTCGACGTGGACGGTAACATTTGGACTGCCGTGTATGGCGAAGGCCGGGTGCTTAAGATTGACAGTGGCGGC
CGCGTCGCTGGAGTGGTGACGCTGCCAACACGCAACATCACCTGCGTCCAATTTGCAGGCACCGAGCTTATCATC
ACATCGGCTGCTGACGACGACGCCGCCGCCGATGCCCCAAGCCGGCGCTACGGAGGCGCCGTCTTCCGGGTCGAC
GTCGGCACCACAGGCCTTGATCTGTTCAAGTTTCGCATGTGA
Gene >OphauG2|5961
ATGACAATGGCCCACGCAGCAGTGGCTCAGTGGAACGTCACGCAGCCGTGGCTGGAGCCCCATTGTGCCCTGGGA
GAGGGGCCCTTTTACGAGTCACAGACTCACTCAATTCGCTTTGTCGACATCAAAAAACGCCAACTGCTCACGGCG
TCGCTCCATGATGGACCCGGGTCGCTGCATGTGCTACAAGTCGACGCTTCTAGTCCAAGTGTCACTGCAGACATT
CAAGGTGTTGACCCGCGCGAGCAAATCGCCGTTGGCGTCAAGCAAGGCCTCGGAGTGCTGGACCGCCGCTCAGGA
CACTGCCGCTTGCTGTCTCGTTTTGCAGCAGGCGGGGAAGACAATGCGCGGCTGAGAAGCAACGACGGCGCTGTT
GATTGCAATGGGCGCTTCTGGCTCGGCAGCATGACGGACTTTTCCTTTGGACAAGTTCAACCCGAGGGTACCTGA
GCAACGAGGCCGTCTATTGTCCTGAGTCACTGACCACGACATACTGCAGGATCACTGTTCCGCTTCTCCGCCATG
GCCGCGGCAGATGTTGCTGTGGCCAATGTTGCGATTCCAAACTCGGTTGGCTGGTCGCCTGATGGCACCATCATG
TACTTTGCCGACTCGCGCGCCCGCCAGATCCGTTCATGGGACTACGATGCTGCAGCCTCGTCGGCTGCTTCTGCG
CTACGGAACCCGCAGGTCTTGTACCAGCATAATGGGCCTGGCGAGCCTGATGGCTTCCGCGTCGACGTGGACGGT
AACATTTGGACTGCCGTGTATGGCGAAGGCCGGGTGCTTAAGATTGACAGTGGCGGCCGCGTCGCTGGAGTGGTG
ACGCTGCCAACACGCAACATCACCTGCGTCCAATTTGCAGGCACCGAGCTTATCATCACATCGGCTGCTGACGAC
GACGCCGCCGCCGATGCCCCAAGCCGGCGCTACGGAGGCGCCGTCTTCCGGGTCGACGTCGGCACCACAGGCCTT
GATCTGTTCAAGTTTCGCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail