Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5948
Gene name
LocationContig_58:17871..19922
Strand-
Gene length (bp)2051
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03129 HGTP_anticodon Anticodon binding domain 1.6E-21 543 634
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 7.9E-08 215 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10179|SYG_SCHPO Putative glycine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grs1 PE=3 SV=1 9 656 0.0E+00
sp|P38088|SYG_YEAST Glycine--tRNA ligase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRS1 PE=1 SV=3 18 655 0.0E+00
sp|Q06817|SYG2_YEAST Glycine--tRNA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRS2 PE=1 SV=1 14 644 0.0E+00
sp|Q5I0G4|SYG_RAT Glycine--tRNA ligase (Fragment) OS=Rattus norvegicus GN=Gars PE=1 SV=1 9 656 0.0E+00
sp|Q9CZD3|SYG_MOUSE Glycine--tRNA ligase OS=Mus musculus GN=Gars PE=1 SV=1 9 656 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10179|SYG_SCHPO Putative glycine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grs1 PE=3 SV=1 9 656 0.0E+00
sp|P38088|SYG_YEAST Glycine--tRNA ligase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRS1 PE=1 SV=3 18 655 0.0E+00
sp|Q06817|SYG2_YEAST Glycine--tRNA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRS2 PE=1 SV=1 14 644 0.0E+00
sp|Q5I0G4|SYG_RAT Glycine--tRNA ligase (Fragment) OS=Rattus norvegicus GN=Gars PE=1 SV=1 9 656 0.0E+00
sp|Q9CZD3|SYG_MOUSE Glycine--tRNA ligase OS=Mus musculus GN=Gars PE=1 SV=1 9 656 0.0E+00
sp|Q5RBL1|SYG_PONAB Glycine--tRNA ligase OS=Pongo abelii GN=GARS PE=2 SV=1 9 656 0.0E+00
sp|P41250|SYG_HUMAN Glycine--tRNA ligase OS=Homo sapiens GN=GARS PE=1 SV=3 9 656 0.0E+00
sp|Q04451|SYG_BOMMO Glycine--tRNA ligase OS=Bombyx mori PE=1 SV=2 12 656 0.0E+00
sp|O23627|SYGM1_ARATH Glycine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana GN=At1g29880 PE=1 SV=1 22 650 0.0E+00
sp|Q10039|SYG_CAEEL Glycine--tRNA ligase OS=Caenorhabditis elegans GN=grs-1 PE=3 SV=2 2 658 0.0E+00
sp|Q8SQZ6|SYG_ENCCU Glycine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_1790 PE=1 SV=1 18 643 1.0E-157
sp|A0B5U4|SYG_METTP Glycine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=glyS PE=3 SV=1 21 639 7.0E-148
sp|Q57681|SYG_METJA Glycine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glyS PE=3 SV=1 13 633 5.0E-142
sp|A9A885|SYG_METM6 Glycine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=glyS PE=3 SV=1 21 633 5.0E-141
sp|Q6M0Q7|SYG_METMP Glycine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=glyS PE=3 SV=1 21 633 2.0E-140
sp|A6URK3|SYG_METVS Glycine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=glyS PE=3 SV=1 21 633 1.0E-139
sp|A6VIK1|SYG_METM7 Glycine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=glyS PE=3 SV=1 21 633 7.0E-139
sp|A4FZX1|SYG_METM5 Glycine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=glyS PE=3 SV=1 21 633 4.0E-137
sp|O29346|SYG_ARCFU Glycine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=glyS PE=3 SV=1 21 641 2.0E-131
sp|O27874|SYG_METTH Glycine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glyS PE=3 SV=1 23 635 2.0E-129
sp|Q9FXG2|SYGC_ARATH Putative glycine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g29870 PE=3 SV=2 22 441 1.0E-124
sp|Q8TYY9|SYG_METKA Glycine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glyS PE=3 SV=1 21 646 2.0E-123
sp|O59235|SYG_PYRHO Glycine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glyS PE=3 SV=1 8 638 2.0E-119
sp|Q9V176|SYG_PYRAB Glycine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glyS PE=3 SV=1 18 639 2.0E-118
sp|C6A317|SYG_THESM Glycine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=glyS PE=3 SV=1 18 638 1.0E-117
sp|Q8U0G2|SYG_PYRFU Glycine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glyS PE=3 SV=1 18 638 4.0E-116
sp|C5A1H0|SYG_THEGJ Glycine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=glyS PE=3 SV=1 14 638 1.0E-114
sp|Q5JID8|SYG_THEKO Glycine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glyS PE=3 SV=1 14 636 4.0E-114
sp|Q9YBF8|SYG_AERPE Glycine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=glyS PE=3 SV=1 23 640 2.0E-98
sp|Q9RSR5|SYG_DEIRA Glycine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glyQS PE=3 SV=2 18 622 5.0E-59
sp|P56206|SYG_THET8 Glycine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glyQS PE=1 SV=3 18 622 2.0E-51
sp|Q72L85|SYG_THET2 Glycine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glyQS PE=3 SV=1 18 622 2.0E-50
sp|Q04Z62|SYG_LEPBL Glycine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=glyQS PE=3 SV=1 20 469 8.0E-43
sp|Q04QV5|SYG_LEPBJ Glycine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=glyQS PE=3 SV=1 20 469 8.0E-43
sp|Q8F6C0|SYG_LEPIN Glycine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glyQS PE=3 SV=1 20 415 6.0E-42
sp|Q72PW7|SYG_LEPIC Glycine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glyQS PE=3 SV=1 20 415 6.0E-42
sp|A5N4L2|SYG_CLOK5 Glycine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glyQS PE=3 SV=1 20 403 1.0E-40
sp|B9DY74|SYG_CLOK1 Glycine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=glyQS PE=3 SV=1 20 403 1.0E-40
sp|B9L0I4|SYG_THERP Glycine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glyQS PE=3 SV=1 20 402 7.0E-39
sp|P9WFV7|SYG_MYCTU Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glyQS PE=1 SV=1 16 415 3.0E-37
sp|P9WFV6|SYG_MYCTO Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glyQS PE=3 SV=1 16 415 3.0E-37
sp|P67033|SYG_MYCBO Glycine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glyQS PE=3 SV=1 16 415 3.0E-37
sp|Q8KAB1|SYG_CHLTE Glycine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glyQS PE=3 SV=1 18 402 5.0E-37
sp|Q8XHL9|SYG_CLOPE Glycine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=glyQS PE=3 SV=1 20 403 9.0E-37
sp|Q8RB46|SYG_CALS4 Glycine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glyQS PE=3 SV=1 20 403 9.0E-37
sp|Q899G6|SYG_CLOTE Glycine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=glyQS PE=3 SV=1 20 403 3.0E-36
sp|Q73Y21|SYG_MYCPA Glycine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glyQS PE=3 SV=1 21 402 9.0E-36
sp|A6LPL6|SYG_CLOB8 Glycine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glyQS PE=3 SV=1 20 402 3.0E-35
sp|C4ZAV7|SYG_EUBR3 Glycine--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glyQS PE=3 SV=1 23 403 4.0E-35
sp|B1HTI6|SYG_LYSSC Glycine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=glyQS PE=3 SV=1 20 399 4.0E-35
sp|Q8FNG6|SYG_COREF Glycine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glyQS PE=3 SV=2 21 402 4.0E-35
sp|Q4A5V9|SYG_MYCS5 Glycine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=glyQS PE=3 SV=1 33 396 5.0E-35
sp|Q8G7W9|SYG_BIFLO Glycine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=glyQS PE=3 SV=1 20 402 1.0E-34
sp|Q97EB8|SYG_CLOAB Glycine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glyQS PE=3 SV=1 20 402 1.0E-34
sp|Q1IXM3|SYG_DEIGD Glycine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=glyQS PE=3 SV=1 18 410 1.0E-34
sp|A3DF15|SYG_CLOTH Glycine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glyQS PE=3 SV=1 20 398 2.0E-34
sp|A1TBP9|SYG_MYCVP Glycine--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glyQS PE=3 SV=1 21 415 8.0E-34
sp|Q7UEU9|SYG_RHOBA Glycine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glyQS PE=3 SV=2 18 394 1.0E-33
sp|Q6A964|SYG_PROAC Glycine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glyQS PE=3 SV=2 21 402 2.0E-33
sp|A4ITQ8|SYG_GEOTN Glycine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glyQS PE=3 SV=1 20 399 3.0E-33
sp|Q7NB88|SYG_MYCGA Glycine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=glyQS PE=3 SV=2 21 443 3.0E-33
sp|Q8NNC6|SYG_CORGL Glycine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glyQS PE=3 SV=1 21 402 4.0E-33
sp|A6TSJ4|SYG_ALKMQ Glycine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glyQS PE=3 SV=1 20 406 4.0E-33
sp|B2S3R1|SYG_TREPS Glycine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=glyQS PE=3 SV=1 20 403 8.0E-33
sp|O83678|SYG_TREPA Glycine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=glyQS PE=3 SV=1 20 403 8.0E-33
sp|Q47RL8|SYG_THEFY Glycine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=glyQS PE=3 SV=1 18 402 8.0E-33
sp|Q5KUC1|SYG_GEOKA Glycine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=glyQS PE=3 SV=1 20 399 8.0E-33
sp|A9KJ36|SYG_CLOPH Glycine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glyQS PE=3 SV=1 20 394 8.0E-33
sp|Q6MTE4|SYG_MYCMS Glycine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glyQS PE=3 SV=1 20 404 1.0E-32
sp|C4Z1I4|SYG_EUBE2 Glycine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glyQS PE=3 SV=1 20 402 1.0E-32
sp|Q5YZT7|SYG_NOCFA Glycine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=glyQS PE=3 SV=1 21 402 1.0E-32
sp|Q2SRY5|SYG_MYCCT Glycine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glyQS PE=3 SV=1 20 404 2.0E-32
sp|B8I2Z6|SYG_CLOCE Glycine--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glyQS PE=3 SV=1 20 394 2.0E-32
sp|B2S075|SYG_BORHD Glycine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=glyQS PE=3 SV=1 20 399 3.0E-32
sp|A8MG73|SYG_ALKOO Glycine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glyQS PE=3 SV=1 20 406 5.0E-32
sp|Q82BR9|SYG_STRAW Glycine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glyQS PE=3 SV=1 20 402 5.0E-32
sp|Q8EW64|SYG_MYCPE Glycine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=glyQS PE=3 SV=1 27 443 8.0E-32
sp|Q6HBZ1|SYG_BACHK Glycine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glyQS PE=3 SV=1 21 398 2.0E-31
sp|Q632E8|SYG_BACCZ Glycine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=glyQS PE=3 SV=1 21 398 3.0E-31
sp|Q72YG8|SYG_BACC1 Glycine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glyQS PE=3 SV=1 21 398 3.0E-31
sp|Q81XT3|SYG_BACAN Glycine--tRNA ligase OS=Bacillus anthracis GN=glyQS PE=3 SV=1 21 398 3.0E-31
sp|Q6F1J8|SYG_MESFL Glycine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=glyQS PE=3 SV=1 18 398 3.0E-31
sp|B9DNL1|SYG_STACT Glycine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=glyQS PE=3 SV=1 21 399 4.0E-31
sp|Q9L2H9|SYG_STRCO Glycine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glyQS PE=3 SV=1 20 402 8.0E-31
sp|B5ZC00|SYG_UREU1 Glycine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=glyQS PE=3 SV=1 33 394 3.0E-30
sp|Q2YT14|SYG_STAAB Glycine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glyQS PE=3 SV=1 20 399 3.0E-30
sp|P67035|SYG_STAAW Glycine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|A8Z4A4|SYG_STAAT Glycine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q6G902|SYG_STAAS Glycine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q6GGD5|SYG_STAAR Glycine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|P99129|SYG_STAAN Glycine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=glyQS PE=1 SV=1 20 399 4.0E-30
sp|P67034|SYG_STAAM Glycine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|A6QHA8|SYG_STAAE Glycine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q5HFJ5|SYG_STAAC Glycine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|A5IT93|SYG_STAA9 Glycine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q2FY08|SYG_STAA8 Glycine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q2FGF8|SYG_STAA3 Glycine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|A6U237|SYG_STAA2 Glycine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|A7X2W2|SYG_STAA1 Glycine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glyQS PE=3 SV=1 20 399 4.0E-30
sp|Q8CSD5|SYG_STAES Glycine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glyQS PE=3 SV=1 21 399 1.0E-29
sp|Q5HNY2|SYG_STAEQ Glycine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glyQS PE=3 SV=1 21 399 1.0E-29
sp|Q4L6R5|SYG_STAHJ Glycine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glyQS PE=3 SV=1 20 399 2.0E-29
sp|Q9PPZ7|SYG_UREPA Glycine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=glyQS PE=3 SV=1 33 394 5.0E-29
sp|B1AJD3|SYG_UREP2 Glycine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=glyQS PE=3 SV=1 33 394 5.0E-29
sp|B9E6V6|SYG_MACCJ Glycine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glyQS PE=3 SV=1 21 399 6.0E-29
sp|Q6AHF7|SYG_LEIXX Glycine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glyQS PE=3 SV=1 21 402 7.0E-28
sp|Q49Y08|SYG_STAS1 Glycine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glyQS PE=3 SV=1 20 399 2.0E-27
sp|Q73RR5|SYG_TREDE Glycine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=glyQS PE=3 SV=1 193 402 3.0E-26
sp|P47493|SYG_MYCGE Glycine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=glyQS PE=3 SV=1 21 402 4.0E-23
sp|O51344|SYG_BORBU Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glyQS PE=3 SV=1 193 396 7.0E-23
sp|Q6MNT9|SYG_BDEBA Glycine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=glyQS PE=3 SV=1 193 466 7.0E-23
sp|B7J1U3|SYG_BORBZ Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=glyQS PE=3 SV=1 193 396 7.0E-23
sp|Q661P8|SYG_BORBP Glycine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glyQS PE=3 SV=1 193 396 1.0E-22
sp|Q0SNE2|SYG_BORAP Glycine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=glyQS PE=3 SV=1 193 403 2.0E-22
sp|B9L0I4|SYG_THERP Glycine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glyQS PE=3 SV=1 490 634 4.0E-22
sp|B9E6V6|SYG_MACCJ Glycine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glyQS PE=3 SV=1 490 637 5.0E-22
sp|Q6AHF7|SYG_LEIXX Glycine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glyQS PE=3 SV=1 495 622 1.0E-21
sp|Q4L6R5|SYG_STAHJ Glycine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glyQS PE=3 SV=1 490 622 3.0E-21
sp|Q899G6|SYG_CLOTE Glycine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=glyQS PE=3 SV=1 490 637 4.0E-21
sp|Q2YT14|SYG_STAAB Glycine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|P67035|SYG_STAAW Glycine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|A8Z4A4|SYG_STAAT Glycine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q6G902|SYG_STAAS Glycine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q6GGD5|SYG_STAAR Glycine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|P99129|SYG_STAAN Glycine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=glyQS PE=1 SV=1 490 622 6.0E-21
sp|P67034|SYG_STAAM Glycine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|A6QHA8|SYG_STAAE Glycine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q5HFJ5|SYG_STAAC Glycine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|A5IT93|SYG_STAA9 Glycine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q2FY08|SYG_STAA8 Glycine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q2FGF8|SYG_STAA3 Glycine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|A6U237|SYG_STAA2 Glycine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|A7X2W2|SYG_STAA1 Glycine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q8CSD5|SYG_STAES Glycine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q5HNY2|SYG_STAEQ Glycine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glyQS PE=3 SV=1 490 622 6.0E-21
sp|Q97EB8|SYG_CLOAB Glycine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glyQS PE=3 SV=1 494 623 7.0E-21
sp|Q9L2H9|SYG_STRCO Glycine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glyQS PE=3 SV=1 490 628 1.0E-20
sp|A5N4L2|SYG_CLOK5 Glycine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glyQS PE=3 SV=1 489 636 2.0E-20
sp|B9DY74|SYG_CLOK1 Glycine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=glyQS PE=3 SV=1 489 636 2.0E-20
sp|Q82BR9|SYG_STRAW Glycine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glyQS PE=3 SV=1 490 628 4.0E-20
sp|B9DNL1|SYG_STACT Glycine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=glyQS PE=3 SV=1 490 622 4.0E-20
sp|Q04Z62|SYG_LEPBL Glycine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=glyQS PE=3 SV=1 483 623 6.0E-20
sp|Q04QV5|SYG_LEPBJ Glycine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=glyQS PE=3 SV=1 483 623 6.0E-20
sp|Q6A964|SYG_PROAC Glycine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glyQS PE=3 SV=2 491 630 6.0E-20
sp|C4Z1I4|SYG_EUBE2 Glycine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glyQS PE=3 SV=1 490 622 8.0E-20
sp|Q8EW64|SYG_MYCPE Glycine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=glyQS PE=3 SV=1 472 640 8.0E-20
sp|P9WFV7|SYG_MYCTU Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glyQS PE=1 SV=1 481 639 9.0E-20
sp|P9WFV6|SYG_MYCTO Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glyQS PE=3 SV=1 481 639 9.0E-20
sp|P67033|SYG_MYCBO Glycine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glyQS PE=3 SV=1 481 639 9.0E-20
sp|Q8NNC6|SYG_CORGL Glycine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glyQS PE=3 SV=1 490 623 1.0E-19
sp|P75425|SYG_MYCPN Glycine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=glyQS PE=3 SV=1 490 623 1.0E-19
sp|Q8FNG6|SYG_COREF Glycine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glyQS PE=3 SV=2 490 623 2.0E-19
sp|Q5YZT7|SYG_NOCFA Glycine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=glyQS PE=3 SV=1 491 628 2.0E-19
sp|P75425|SYG_MYCPN Glycine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=glyQS PE=3 SV=1 165 396 2.0E-19
sp|Q8F6C0|SYG_LEPIN Glycine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glyQS PE=3 SV=1 483 622 3.0E-19
sp|A1TBP9|SYG_MYCVP Glycine--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glyQS PE=3 SV=1 481 639 3.0E-19
sp|Q47RL8|SYG_THEFY Glycine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=glyQS PE=3 SV=1 491 622 3.0E-19
sp|Q49Y08|SYG_STAS1 Glycine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glyQS PE=3 SV=1 484 622 3.0E-19
sp|Q72PW7|SYG_LEPIC Glycine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glyQS PE=3 SV=1 483 622 4.0E-19
sp|A3DF15|SYG_CLOTH Glycine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glyQS PE=3 SV=1 492 637 5.0E-19
sp|A6LPL6|SYG_CLOB8 Glycine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glyQS PE=3 SV=1 494 634 7.0E-19
sp|Q73Y21|SYG_MYCPA Glycine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glyQS PE=3 SV=1 481 638 1.0E-18
sp|Q7NB88|SYG_MYCGA Glycine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=glyQS PE=3 SV=2 456 634 1.0E-18
sp|Q8XHL9|SYG_CLOPE Glycine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=glyQS PE=3 SV=1 494 639 2.0E-18
sp|B8I2Z6|SYG_CLOCE Glycine--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glyQS PE=3 SV=1 494 622 2.0E-18
sp|Q4A5V9|SYG_MYCS5 Glycine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=glyQS PE=3 SV=1 492 630 6.0E-18
sp|Q5KUC1|SYG_GEOKA Glycine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=glyQS PE=3 SV=1 490 628 1.0E-17
sp|Q8G7W9|SYG_BIFLO Glycine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=glyQS PE=3 SV=1 494 636 2.0E-17
sp|Q1IXM3|SYG_DEIGD Glycine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=glyQS PE=3 SV=1 490 622 2.0E-17
sp|A4ITQ8|SYG_GEOTN Glycine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glyQS PE=3 SV=1 490 628 2.0E-17
sp|B1HTI6|SYG_LYSSC Glycine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=glyQS PE=3 SV=1 489 622 3.0E-17
sp|A9KJ36|SYG_CLOPH Glycine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glyQS PE=3 SV=1 490 622 3.0E-17
sp|Q6MTE4|SYG_MYCMS Glycine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glyQS PE=3 SV=1 490 622 4.0E-17
sp|Q2SRY5|SYG_MYCCT Glycine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glyQS PE=3 SV=1 490 622 6.0E-17
sp|Q8RB46|SYG_CALS4 Glycine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glyQS PE=3 SV=1 494 624 9.0E-17
sp|Q6MNT9|SYG_BDEBA Glycine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=glyQS PE=3 SV=1 491 623 1.0E-16
sp|A6TSJ4|SYG_ALKMQ Glycine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glyQS PE=3 SV=1 481 623 3.0E-16
sp|Q8KAB1|SYG_CHLTE Glycine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glyQS PE=3 SV=1 483 630 5.0E-16
sp|Q6HBZ1|SYG_BACHK Glycine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glyQS PE=3 SV=1 490 622 6.0E-16
sp|Q632E8|SYG_BACCZ Glycine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=glyQS PE=3 SV=1 490 622 6.0E-16
sp|Q72YG8|SYG_BACC1 Glycine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glyQS PE=3 SV=1 490 622 6.0E-16
sp|Q81XT3|SYG_BACAN Glycine--tRNA ligase OS=Bacillus anthracis GN=glyQS PE=3 SV=1 490 622 6.0E-16
sp|Q6F1J8|SYG_MESFL Glycine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=glyQS PE=3 SV=1 497 624 1.0E-15
sp|Q73RR5|SYG_TREDE Glycine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=glyQS PE=3 SV=1 494 640 2.0E-15
sp|B2S075|SYG_BORHD Glycine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=glyQS PE=3 SV=1 483 634 6.0E-15
sp|C4ZAV7|SYG_EUBR3 Glycine--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glyQS PE=3 SV=1 490 622 9.0E-15
sp|A8MG73|SYG_ALKOO Glycine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glyQS PE=3 SV=1 485 622 2.0E-14
sp|O51344|SYG_BORBU Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glyQS PE=3 SV=1 494 644 3.0E-14
sp|Q661P8|SYG_BORBP Glycine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glyQS PE=3 SV=1 472 644 4.0E-14
sp|B7J1U3|SYG_BORBZ Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=glyQS PE=3 SV=1 494 644 7.0E-14
sp|B5ZC00|SYG_UREU1 Glycine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=glyQS PE=3 SV=1 490 622 9.0E-14
sp|P47493|SYG_MYCGE Glycine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=glyQS PE=3 SV=1 490 622 2.0E-13
sp|Q0SNE2|SYG_BORAP Glycine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=glyQS PE=3 SV=1 472 641 3.0E-13
sp|Q7UEU9|SYG_RHOBA Glycine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glyQS PE=3 SV=2 494 639 6.0E-13
sp|Q9PPZ7|SYG_UREPA Glycine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=glyQS PE=3 SV=1 490 622 2.0E-12
sp|B1AJD3|SYG_UREP2 Glycine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=glyQS PE=3 SV=1 490 622 2.0E-12
sp|B2S3R1|SYG_TREPS Glycine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=glyQS PE=3 SV=1 493 634 9.0E-12
sp|O83678|SYG_TREPA Glycine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=glyQS PE=3 SV=1 493 634 9.0E-12
sp|Q0SNE2|SYG_BORAP Glycine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=glyQS PE=3 SV=1 20 109 2.0E-11
sp|O51344|SYG_BORBU Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glyQS PE=3 SV=1 20 109 7.0E-11
sp|B7J1U3|SYG_BORBZ Glycine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=glyQS PE=3 SV=1 20 109 7.0E-11
sp|Q661P8|SYG_BORBP Glycine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glyQS PE=3 SV=1 20 109 7.0E-11
sp|Q73RR5|SYG_TREDE Glycine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=glyQS PE=3 SV=1 20 123 5.0E-10
sp|Q6MNT9|SYG_BDEBA Glycine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=glyQS PE=3 SV=1 18 110 1.0E-08
sp|Q5JF49|SYP_THEKO Proline--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=proS PE=3 SV=1 499 638 2.0E-07
sp|A0M4Z3|SYP_GRAFK Proline--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=proS PE=3 SV=1 498 641 4.0E-07
sp|B2G6V0|SYP_LACRJ Proline--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=proS PE=3 SV=1 498 636 5.0E-07
sp|A5VJD4|SYP_LACRD Proline--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=proS PE=3 SV=1 498 636 5.0E-07
sp|C0QY98|SYP_BRAHW Proline--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=proS PE=3 SV=1 490 634 2.0E-06
sp|A9B562|SYP_HERA2 Proline--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=proS PE=3 SV=1 499 617 3.0E-06
sp|B8CW65|SYP_HALOH Proline--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=proS PE=3 SV=1 499 640 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2073
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5948 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7943
Ophiocordyceps camponoti-floridani Ophcf2|06482
Ophiocordyceps camponoti-rufipedis Ophun1|6011
Ophiocordyceps kimflemingae Ophio5|5466
Ophiocordyceps subramaniannii Hirsu2|2396

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5948
MTSTATTLKGQILEKPLLDAMLRRRMFYTPSFEIYGGVAGLYDYGPPGCALQANIVDLWRKHFVLEEDMLEVDCT
VLTPHEVLKTSGHVDKFADWMCKDPKNGEILRADHFVESVLEARLNGDKEARGQKVEEKDDAKKKKKKAKTDAIK
LEDAVVKEYEQVLARIDNYDGPQLGELIKKYDLKNPATDVLPSDPVSFNLMFQTSIGPSSNLPGYLRPETAQGQF
LNFAKLLDFNQGQMPFASASIGKSYRNEISPRAGLLRVREFLMAEIEHFVDPKGGKKHSRFHEVNKVQLVLLDRE
TQLAGKTATRKVSIGQAVKEGLVDNETLGYFLARIHLFLEKIGVDLSKMRFRQHMENEMAHYACDCWDAELLTTS
GWVECVGCADRSAYDLTVHAKKTGASMVVRERLDEPLVVQEWQVDIEKKKFGPRFKKDAKAVETALMATSQEQRE
ALSKQLSEAGKFSLKVPDVSSGNVDVTNDLVKIEFQKRVENTREFTPNVIEPSFGIGRILYALIEHNFWTRASEG
GDLARGVLSFPPTISPTKVLIVPLSSNAQFDPSVMKLSQQLRRFGISSKVDDSSASIGKRYSRNDELGTPLGITI
DFQTLQDGTITLRDRDSTNQVRADQGKILEAVKSLVDGSKDWDKVASELPKFEGQELEMAGR*
Coding >OphauG2|5948
ATGACTTCGACCGCCACAACCCTCAAGGGCCAGATCCTTGAAAAGCCTCTTCTCGACGCGATGCTGCGGCGGCGC
ATGTTTTATACGCCTTCCTTTGAAATCTATGGTGGTGTTGCTGGTCTCTACGACTACGGGCCTCCTGGTTGCGCG
CTCCAGGCAAATATTGTTGATCTCTGGCGCAAACATTTTGTCCTAGAAGAAGACATGCTTGAAGTCGACTGCACC
GTCCTCACGCCTCATGAAGTCCTCAAAACCAGTGGACACGTTGACAAGTTTGCCGATTGGATGTGCAAAGACCCC
AAAAATGGCGAGATTTTACGAGCCGACCACTTTGTCGAGTCGGTTCTCGAGGCTAGACTCAACGGCGATAAGGAG
GCCCGTGGTCAAAAAGTAGAGGAAAAGGACGATGCCAAGAAGAAGAAGAAGAAGGCAAAGACTGATGCCATCAAA
CTCGAAGACGCCGTCGTCAAAGAATATGAGCAAGTTTTGGCCCGCATCGACAATTATGATGGCCCACAACTCGGA
GAGCTCATCAAAAAGTACGATCTCAAGAACCCGGCTACAGATGTCTTACCATCAGATCCTGTGTCTTTCAACCTC
ATGTTCCAAACTTCAATCGGCCCCAGCAGCAATCTTCCAGGCTATCTTCGTCCAGAAACTGCCCAGGGCCAGTTC
CTCAACTTTGCCAAGCTTCTGGATTTCAACCAGGGCCAAATGCCCTTTGCCTCAGCATCAATTGGTAAATCCTAC
CGGAACGAAATCTCGCCTCGTGCTGGTCTTTTGCGCGTGCGGGAGTTCCTCATGGCTGAGATTGAGCATTTTGTC
GACCCAAAGGGTGGCAAGAAACACAGTCGATTTCACGAGGTTAACAAGGTCCAACTTGTACTCCTTGATCGCGAG
ACACAATTGGCTGGTAAGACGGCAACTAGGAAAGTTTCCATTGGCCAGGCTGTCAAAGAAGGCCTCGTTGACAAC
GAGACACTTGGTTACTTCCTCGCTCGCATCCACCTCTTCCTTGAGAAGATTGGTGTCGATCTGTCCAAGATGCGT
TTCCGCCAGCACATGGAGAACGAAATGGCTCACTACGCTTGTGACTGCTGGGATGCCGAGTTGCTTACAACCTCT
GGTTGGGTTGAGTGTGTTGGCTGTGCTGATCGCAGCGCATATGATCTCACTGTGCATGCGAAGAAGACGGGCGCC
TCCATGGTTGTCCGGGAGCGCCTTGACGAGCCACTTGTTGTCCAAGAGTGGCAGGTTGATATCGAAAAGAAGAAG
TTTGGGCCCCGGTTCAAAAAAGATGCAAAGGCTGTAGAAACGGCTCTGATGGCGACCTCGCAGGAGCAGCGGGAG
GCTCTATCTAAGCAACTGAGCGAAGCGGGTAAATTCAGCCTCAAGGTGCCCGACGTGTCAAGCGGCAATGTCGAC
GTGACAAACGACTTGGTTAAGATTGAGTTTCAAAAGAGGGTAGAGAATACGCGAGAGTTTACACCCAATGTCATC
GAGCCATCTTTTGGCATTGGTCGCATTCTATACGCCCTTATTGAGCATAATTTCTGGACACGGGCCAGCGAAGGC
GGCGACTTGGCTCGTGGTGTTCTTTCTTTTCCACCGACTATTTCACCTACCAAGGTGCTCATTGTGCCGCTCTCT
TCCAATGCCCAATTCGACCCGAGTGTCATGAAGCTTTCGCAGCAGCTGAGAAGGTTTGGAATATCCAGTAAAGTT
GATGACTCGTCGGCCAGTATCGGCAAGCGCTACAGCAGAAACGACGAGCTAGGCACGCCCCTGGGAATCACAATC
GACTTCCAGACGTTGCAAGACGGGACTATTACACTACGAGATCGCGACTCGACGAACCAAGTACGCGCCGACCAA
GGAAAAATTCTCGAGGCGGTCAAGTCGCTGGTTGATGGTAGCAAAGACTGGGATAAAGTTGCGTCGGAGCTACCC
AAGTTTGAGGGTCAGGAGTTGGAAATGGCTGGGCGTTAG
Transcript >OphauG2|5948
ATGACTTCGACCGCCACAACCCTCAAGGGCCAGATCCTTGAAAAGCCTCTTCTCGACGCGATGCTGCGGCGGCGC
ATGTTTTATACGCCTTCCTTTGAAATCTATGGTGGTGTTGCTGGTCTCTACGACTACGGGCCTCCTGGTTGCGCG
CTCCAGGCAAATATTGTTGATCTCTGGCGCAAACATTTTGTCCTAGAAGAAGACATGCTTGAAGTCGACTGCACC
GTCCTCACGCCTCATGAAGTCCTCAAAACCAGTGGACACGTTGACAAGTTTGCCGATTGGATGTGCAAAGACCCC
AAAAATGGCGAGATTTTACGAGCCGACCACTTTGTCGAGTCGGTTCTCGAGGCTAGACTCAACGGCGATAAGGAG
GCCCGTGGTCAAAAAGTAGAGGAAAAGGACGATGCCAAGAAGAAGAAGAAGAAGGCAAAGACTGATGCCATCAAA
CTCGAAGACGCCGTCGTCAAAGAATATGAGCAAGTTTTGGCCCGCATCGACAATTATGATGGCCCACAACTCGGA
GAGCTCATCAAAAAGTACGATCTCAAGAACCCGGCTACAGATGTCTTACCATCAGATCCTGTGTCTTTCAACCTC
ATGTTCCAAACTTCAATCGGCCCCAGCAGCAATCTTCCAGGCTATCTTCGTCCAGAAACTGCCCAGGGCCAGTTC
CTCAACTTTGCCAAGCTTCTGGATTTCAACCAGGGCCAAATGCCCTTTGCCTCAGCATCAATTGGTAAATCCTAC
CGGAACGAAATCTCGCCTCGTGCTGGTCTTTTGCGCGTGCGGGAGTTCCTCATGGCTGAGATTGAGCATTTTGTC
GACCCAAAGGGTGGCAAGAAACACAGTCGATTTCACGAGGTTAACAAGGTCCAACTTGTACTCCTTGATCGCGAG
ACACAATTGGCTGGTAAGACGGCAACTAGGAAAGTTTCCATTGGCCAGGCTGTCAAAGAAGGCCTCGTTGACAAC
GAGACACTTGGTTACTTCCTCGCTCGCATCCACCTCTTCCTTGAGAAGATTGGTGTCGATCTGTCCAAGATGCGT
TTCCGCCAGCACATGGAGAACGAAATGGCTCACTACGCTTGTGACTGCTGGGATGCCGAGTTGCTTACAACCTCT
GGTTGGGTTGAGTGTGTTGGCTGTGCTGATCGCAGCGCATATGATCTCACTGTGCATGCGAAGAAGACGGGCGCC
TCCATGGTTGTCCGGGAGCGCCTTGACGAGCCACTTGTTGTCCAAGAGTGGCAGGTTGATATCGAAAAGAAGAAG
TTTGGGCCCCGGTTCAAAAAAGATGCAAAGGCTGTAGAAACGGCTCTGATGGCGACCTCGCAGGAGCAGCGGGAG
GCTCTATCTAAGCAACTGAGCGAAGCGGGTAAATTCAGCCTCAAGGTGCCCGACGTGTCAAGCGGCAATGTCGAC
GTGACAAACGACTTGGTTAAGATTGAGTTTCAAAAGAGGGTAGAGAATACGCGAGAGTTTACACCCAATGTCATC
GAGCCATCTTTTGGCATTGGTCGCATTCTATACGCCCTTATTGAGCATAATTTCTGGACACGGGCCAGCGAAGGC
GGCGACTTGGCTCGTGGTGTTCTTTCTTTTCCACCGACTATTTCACCTACCAAGGTGCTCATTGTGCCGCTCTCT
TCCAATGCCCAATTCGACCCGAGTGTCATGAAGCTTTCGCAGCAGCTGAGAAGGTTTGGAATATCCAGTAAAGTT
GATGACTCGTCGGCCAGTATCGGCAAGCGCTACAGCAGAAACGACGAGCTAGGCACGCCCCTGGGAATCACAATC
GACTTCCAGACGTTGCAAGACGGGACTATTACACTACGAGATCGCGACTCGACGAACCAAGTACGCGCCGACCAA
GGAAAAATTCTCGAGGCGGTCAAGTCGCTGGTTGATGGTAGCAAAGACTGGGATAAAGTTGCGTCGGAGCTACCC
AAGTTTGAGGGTCAGGAGTTGGAAATGGCTGGGCGTTAG
Gene >OphauG2|5948
ATGACTTCGACCGCCACAACCCTCAAGGGCCAGATCCTTGAAAAGCCTCTTCTCGACGCGATGCTGCGGCGGCGC
ATGTTTTATACGCCTTCCTTTGAAATCTATGGTGGTGTTGCTGGTCTCTACGACTACGGGCCTCCTGGTTGCGCG
CTCCAGGCAAATATTGTTGATCTCTGGCGCAAACATTTTGTCCTAGAAGAAGACATGCTTGAAGTCGACTGCACC
GTCCTCACGCCTCATGAAGTCCTCAAAACCAGTGGACACGTTGACAAGTTTGCCGATTGGATGTGCAAAGACCCC
AAAAATGGCGAGATTTTACGAGCCGACCACTTTGTCGAGTCGGTTCTCGAGGCTAGACTCAACGGCGATAAGGAG
GCCCGTGGTCAAAAAGTAGAGGAAAAGGACGATGCCAAGAAGAAGAAGAAGAAGGCAAAGACTGATGCCATCAAA
CTCGAAGACGCCGTCGTCAAAGAATATGAGCAAGTTTTGGCCCGCATCGACAATTATGATGGCCCACAACTCGGA
GAGCTCATCAAAAAGTACGATCTCAAGAACCCGGCTACAGATGTCTTACCATCAGATCCTGTGTCTTTCAACCTC
ATGTTCCAAACTTCAATCGGCCCCAGCAGCAATCTTCCAGGCTATCTTCGTCCAGAAACTGCCCAGGGCCAGTTC
CTCAACTTTGCCAAGCTTCTGGATTTCAACCAGGGCCAAATGCCCTTTGCCTCAGCATCAATTGGTAAATCCTAC
CGGAACGAAATCTCGCCTCGTGCTGGTCTTTTGCGCGTGCGGGAGTTCCTCATGGCTGAGATTGAGCATTTTGTC
GACCCAAAGGGTGGCAAGAAACACAGTCGATTTCACGAGGTTAACAAGGTCCAACTTGTACTCCTTGATCGCGAG
ACACAATTGGCTGGTAAGACGGCAACTAGGAAAGTTTCCATTGGCCAGGCTGTCAAAGAAGGCCTCGTTGACAAC
GAGACACTTGGTTACTTCCTCGCTCGCATCCACCTCTTCCTTGAGAAGATTGGTGTCGATCTGTCCAAGATGCGT
TTCCGCCAGCACATGGAGAACGAAATGGCTCACTACGCTTGTGACTGCTGGGATGCCGAGTTGCTTACAACCTCT
GGTTGGGTTGAGTGTGTTGGCTGTGCTGATCGCAGCGCATATGATCTCACTGTGCATGCGAAGAAGACGGGCGCC
TCCATGGTTGTCCGGGAGCGCCTTGACGAGCCACTTGTTGTCCAAGAGTGGCAGGTTGATATCGAAAAGAAGAAG
TTTGGGCCCCGGTTCAAAAAAGATGCAAAGGCTGTAGAAACGGCTCTGATGGCGACCTCGCAGGAGCAGCGGGAG
GCTCTATCTAAGCAACTGAGCGAAGCGGGTAAATTCAGCCTCAAGGTGCCCGACGTGTCAAGCGGCAATGTCGAC
GTGACAAACGACTTGGTTAAGATTGAGTTTCAAAAGAGGGTAGAGAATACGCGAGAGTTTACACCCAATGTCATC
GAGCCATCTTTTGGCATTGGTCGCATTCTATACGCCCTTATTGAGCATAATTTCTGGACACGGGCCAGCGAAGGC
GGCGACTTGGCTCGTGGTGTAAGCTTACTGTTCTTTTAGTCGCCCAAGGATGACTTGCAGTGGCTAATGCCAGAC
AACAGGTTCTTTCTTTTCCACCGACTATTTCACCTACCAAGGTGCTCATTGTGCCGCTCTCTTCCAATGCCCAAT
TCGACCCGAGTGTCATGAAGCTTTCGCAGCAGCTGAGAAGGTTTGGAATATCCAGTAAAGTTGATGACTCGTCGG
CCAGTATCGGCAAGCGCTACAGCAGAAACGACGAGCTAGGCACGCCCCTGGGAATCACAATCGACTTCCAGACGT
TGCAAGACGGGACTATTACACTACGAGATCGCGACTCGACGAACCAAGTACGCGCCGACCAAGGAAAAATTCTCG
AGGCGGTCAAGTCGCTGGTTGATGGTAGCAAAGACTGGGATAAAGTTGCGTCGGAGCTACCCAAGTTTGAGGGTC
AGGAGTTGGAAATGGCTGGGCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail