Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5945
Gene name
LocationContig_58:5997..9629
Strand-
Gene length (bp)3632
Transcript length (bp)3522
Coding sequence length (bp)3522
Protein length (aa) 1174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 6.5E-06 660 692
PF00806 PUF Pumilio-family RNA binding repeat 1.9E-02 695 729
PF00806 PUF Pumilio-family RNA binding repeat 2.8E-02 738 756
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-12 448 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 448 962 7.0E-130
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 444 940 1.0E-118
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 572 954 5.0E-95
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 458 946 3.0E-90
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 646 951 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 448 962 7.0E-130
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 444 940 1.0E-118
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 572 954 5.0E-95
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 458 946 3.0E-90
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 646 951 5.0E-28
sp|P25339|PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF4 PE=1 SV=2 661 891 7.0E-21
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 648 928 4.0E-18
sp|Q1PFN9|PUM9_ARATH Pumilio homolog 9 OS=Arabidopsis thaliana GN=APUM9 PE=2 SV=1 628 891 2.0E-17
sp|Q9LVC3|PUM12_ARATH Pumilio homolog 12 OS=Arabidopsis thaliana GN=APUM12 PE=2 SV=2 648 824 3.0E-17
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 648 928 1.0E-16
sp|Q9LDW3|PUM11_ARATH Pumilio homolog 11 OS=Arabidopsis thaliana GN=APUM11 PE=3 SV=2 647 824 1.0E-16
sp|Q9LJX4|PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana GN=APUM5 PE=1 SV=2 633 928 3.0E-16
sp|Q9LM20|PUM8_ARATH Putative pumilio homolog 8, chloroplastic OS=Arabidopsis thaliana GN=APUM8 PE=3 SV=2 655 885 4.0E-16
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 648 928 6.0E-16
sp|Q9SS47|PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana GN=APUM4 PE=1 SV=2 655 928 3.0E-15
sp|Q9LP21|PUM10_ARATH Putative pumilio homolog 10 OS=Arabidopsis thaliana GN=APUM10 PE=3 SV=2 652 922 2.0E-14
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 633 912 8.0E-14
sp|Q9C9R6|PUM7_ARATH Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana GN=APUM7 PE=3 SV=2 655 886 2.0E-13
sp|P25822|PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster GN=pum PE=1 SV=2 647 891 7.0E-13
sp|Q09829|YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.03c PE=3 SV=1 656 901 2.0E-12
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 630 872 1.0E-11
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 630 872 1.0E-11
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 647 867 1.0E-11
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 647 867 1.0E-11
sp|E3WDQ9|PUM2_XENLA Pumilio homolog 2 OS=Xenopus laevis GN=pum2 PE=1 SV=1 647 867 2.0E-11
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 647 867 3.0E-11
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 647 867 5.0E-11
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 647 882 6.0E-11
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 647 867 7.0E-11
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 647 882 9.0E-11
sp|O94462|PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf3 PE=2 SV=4 662 872 2.0E-10
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 633 835 3.0E-10
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 633 846 5.0E-10
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 633 803 5.0E-10
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 633 835 5.0E-10
sp|Q07807|PUF3_YEAST mRNA-binding protein PUF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF3 PE=1 SV=1 645 860 8.0E-10
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 633 835 9.0E-10
sp|P39016|MPT5_YEAST Suppressor protein MPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPT5 PE=1 SV=2 658 824 1.0E-09
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 633 835 1.0E-09
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 633 835 1.0E-09
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 630 872 3.0E-09
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 633 836 4.0E-09
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 446 524 2.0E-07
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 434 539 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5945
MAPAYSTRHSASQNSSQPSAHSTSAAEASGPLPSGPLSRSAFGLAGAINHNGIMAANSRSGAGSPSHELAGSSRL
FSKRAREIQAQEGIPGLPINPWGGPPTSGNSTPLRENIPESPTDGFPDFGQLPTPESLPQTRRARAGTVPSRFSP
GGPANGLLNVPNIAPVSTRATPSQTPYNKSPSPSFEHTENTSSGSTLLSRLRAGSMPQRSPFHSMTSTASPFGPS
IFSSNWNPAGVGRERASTLASIASIGSNGPSSPAQSQFSREGGGESNVHMRTLDYLGLAETPQPPRAQLATPYLA
NMAYSTQPSRFRSYSVNNKDKYADDEDEYEDYAAVLQDQLAATQAAIHNHNLAVQAFVNQASATRPRAHTAGVLD
APGSRFVPTYAGPGSGAPSNMASAGGEMRVADNHEYEDIAQAMAGVSIGRCMSRNAGLLSAEEQGLEGPTSALWL
GGVPTSTTTSTLTEMFKAHGPILSARVLTHKNCGFVNFEKVESAMSAKNSLNGKEIFPGAGPIRINFAKPPSASN
TPGPDGVFPSPSPDPFGKGGQDGGHSAASAGPSGQAAGLASASTGAPRLGEMMADIADIVVQFGATEDDKSQISR
SVTSALHYQGYAEEIPPIREPSQTRLHDAPRLRDIRKRIDNQLMPQAEIESVAMDMLPEIAELSSDYLGNTVVQK
LFEHCSDAVRDAMLEKVAPHLAEIGVHKNGTWAAQKIIDVCKTPSQMSTIVEHLRPYTVPLFLDQYGNYVLQGCL
KFGPPYNDFIFEAMLSRLWDIAQGRFGARAMRACLESHHASKNQQRMLAAAIALNSVPLATNANGALLLTWLLDT
CTFPQRRTVLSPRLEPCLVHLCTHKVAYLTVLKVINQKAEADARDAMLRAMFFSPNDQVLEAILSDHSCGATLIF
KVLTTPFFDDRIRAQVVENVKRVLCNIKAQPNQGYKRLMDEVGLSTRAPASSRDGNASSEPRQRPAPRQGGSNAQ
HAHGKQPYFNANAVNPAVSAGAFDAGYGVARSDSTEASLAGFPAYGQGLVYNAAAPATVNPAMNLQHLQYQQSLM
ARGTPQMNYPFPIQAGYGPYGAPAATVDHYRQQNVANGTPVQMPSPQLSHMAPSQPSYGQAGFGVPMGGAFGYGN
VGAMQAINYMHQEPNNSNTNSNNAPANSQHHNTHNNHNNSNSRRGRVR*
Coding >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCT
CCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCCCAGAGTCTCCAACCGACGGATTCCCCGACTTTGGT
CAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAGCAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCC
GGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTGCCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACA
CCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTGAAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGG
CTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATTCCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCA
ATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTGAAAGAGCATCCACTCTTGCCAGTATTGCTAGCATT
GGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATG
CGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGCCTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCA
AACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTTATTCAGTCAACAACAAGGACAAGTATGCAGATGAC
GAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACCAACTGGCTGCCACACAGGCGGCCATCCACAACCAC
AACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGAC
GCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCGGCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGG
GGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACATTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGA
TGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGCAAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTT
GGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTGAGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCC
CGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTGAAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGT
CTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTCGCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAAC
ACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCAC
AGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGCTGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGT
GAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTGGGGCAACTGAGGACGACAAGAGCCAGATCAGCCGC
AGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGG
CTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATTGAA
AGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCTCGTCTGACTACCTGGGCAACACTGTGGTGCAGAAA
CTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGCTGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGC
GTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTGACGTTTGCAAGACGCCGAGCCAAATGTCCACCATT
GTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGGACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTC
AAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGATGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGC
TTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACCATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCC
GCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCAATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACG
TGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCCTGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAG
GTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGGCCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCC
ATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCCTGAGCGACCATTCGTGTGGCGCAACGCTCATCTTC
AAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGGCCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGC
AACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCATGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCG
TCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGCGCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAG
CATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCGTGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCC
GGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTTTGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTG
TACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGAATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATG
GCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTCAAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCC
ACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCACTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCAC
ATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTGGAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAAC
GTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGCCCAACAATAGCAATACCAACAGCAACAATGCCCCG
GCCAATAGTCAGCATCACAACACGCACAACAATCACAACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Transcript >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCT
CCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCCCAGAGTCTCCAACCGACGGATTCCCCGACTTTGGT
CAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAGCAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCC
GGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTGCCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACA
CCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTGAAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGG
CTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATTCCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCA
ATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTGAAAGAGCATCCACTCTTGCCAGTATTGCTAGCATT
GGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATG
CGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGCCTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCA
AACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTTATTCAGTCAACAACAAGGACAAGTATGCAGATGAC
GAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACCAACTGGCTGCCACACAGGCGGCCATCCACAACCAC
AACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGAC
GCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCGGCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGG
GGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACATTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGA
TGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGCAAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTT
GGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTGAGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCC
CGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTGAAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGT
CTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTCGCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAAC
ACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCAC
AGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGCTGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGT
GAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTGGGGCAACTGAGGACGACAAGAGCCAGATCAGCCGC
AGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGG
CTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATTGAA
AGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCTCGTCTGACTACCTGGGCAACACTGTGGTGCAGAAA
CTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGCTGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGC
GTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTGACGTTTGCAAGACGCCGAGCCAAATGTCCACCATT
GTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGGACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTC
AAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGATGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGC
TTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACCATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCC
GCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCAATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACG
TGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCCTGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAG
GTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGGCCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCC
ATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCCTGAGCGACCATTCGTGTGGCGCAACGCTCATCTTC
AAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGGCCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGC
AACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCATGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCG
TCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGCGCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAG
CATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCGTGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCC
GGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTTTGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTG
TACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGAATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATG
GCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTCAAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCC
ACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCACTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCAC
ATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTGGAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAAC
GTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGCCCAACAATAGCAATACCAACAGCAACAATGCCCCG
GCCAATAGTCAGCATCACAACACGCACAACAATCACAACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Gene >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGGTTTGTGCCTGCATATTTGAATTTTTAGTTTTTGGAGGCGCTTTCAACCTATGCTCTATTCAGC
CAATGCTGACGCGTGTTTGTTTTTTGTTTTTTTTCCTTGTTGTCAGAGCACGCGAGATTCAGGCTCAAGAAGGCA
TTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCTCCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCC
CAGAGTCTCCAACCGACGGATTCCCCGACTTTGGTCAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAG
CAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCCGGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTG
CCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACACCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTG
AAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGGCTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATT
CCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCAATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTG
AAAGAGCATCCACTCTTGCCAGTATTGCTAGCATTGGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCT
CGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATGCGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGC
CTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCAAACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTT
ATTCAGTCAACAACAAGGACAAGTATGCAGATGACGAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACC
AACTGGCTGCCACACAGGCGGCCATCCACAACCACAACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCA
CGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGACGCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCG
GCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGGGGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACA
TTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGATGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGC
AAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTTGGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTG
AGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCCCGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTG
AAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGTCTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTC
GCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAACACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAG
ATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCACAGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGC
TGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGTGAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTG
GGGCAACTGAGGACGACAAGAGCCAGATCAGCCGCAGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGG
AGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGGCTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCA
TTGACAATCAGCTGATGCCGCAAGCCGAGATTGAAAGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCT
CGTCTGACTACCTGGGCAACACTGTGGTGCAGAAACTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGC
TGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGCGTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTG
ACGTTTGCAAGACGCCGAGCCAAATGTCCACCATTGTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGG
ACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTCAAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGA
TGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGCTTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACC
ATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCCGCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCA
ATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACGTGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCC
TGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAGGTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGG
CCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCCATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCC
TGAGCGACCATTCGTGTGGCGCAACGCTCATCTTCAAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGG
CCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGCAACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCA
TGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCGTCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGC
GCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAGCATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCG
TGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCCGGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTT
TGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTGTACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGA
ATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATGGCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTC
AAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCCACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCA
CTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCACATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTG
GAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAACGTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGC
CCAACAATAGCAATACCAACAGCAACAATGCCCCGGCCAATAGTCAGCATCACAACACGCACAACAATCACAACA
ACAGTAATTCTAGGCGCGGTCGGGTACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail