Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5945
Gene name
LocationContig_58:5997..9629
Strand-
Gene length (bp)3632
Transcript length (bp)3522
Coding sequence length (bp)3522
Protein length (aa) 1174

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 6.5E-06 660 692
PF00806 PUF Pumilio-family RNA binding repeat 1.9E-02 695 729
PF00806 PUF Pumilio-family RNA binding repeat 2.8E-02 738 756
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-12 448 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 448 962 7.0E-130
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 444 940 1.0E-118
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 572 954 5.0E-95
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 458 946 3.0E-90
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 646 951 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 448 962 7.0E-130
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 444 940 1.0E-118
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 572 954 5.0E-95
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 458 946 3.0E-90
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 646 951 5.0E-28
sp|P25339|PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF4 PE=1 SV=2 661 891 7.0E-21
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 648 928 4.0E-18
sp|Q1PFN9|PUM9_ARATH Pumilio homolog 9 OS=Arabidopsis thaliana GN=APUM9 PE=2 SV=1 628 891 2.0E-17
sp|Q9LVC3|PUM12_ARATH Pumilio homolog 12 OS=Arabidopsis thaliana GN=APUM12 PE=2 SV=2 648 824 3.0E-17
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 648 928 1.0E-16
sp|Q9LDW3|PUM11_ARATH Pumilio homolog 11 OS=Arabidopsis thaliana GN=APUM11 PE=3 SV=2 647 824 1.0E-16
sp|Q9LJX4|PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana GN=APUM5 PE=1 SV=2 633 928 3.0E-16
sp|Q9LM20|PUM8_ARATH Putative pumilio homolog 8, chloroplastic OS=Arabidopsis thaliana GN=APUM8 PE=3 SV=2 655 885 4.0E-16
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 648 928 6.0E-16
sp|Q9SS47|PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana GN=APUM4 PE=1 SV=2 655 928 3.0E-15
sp|Q9LP21|PUM10_ARATH Putative pumilio homolog 10 OS=Arabidopsis thaliana GN=APUM10 PE=3 SV=2 652 922 2.0E-14
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 633 912 8.0E-14
sp|Q9C9R6|PUM7_ARATH Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana GN=APUM7 PE=3 SV=2 655 886 2.0E-13
sp|P25822|PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster GN=pum PE=1 SV=2 647 891 7.0E-13
sp|Q09829|YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.03c PE=3 SV=1 656 901 2.0E-12
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 630 872 1.0E-11
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 630 872 1.0E-11
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 647 867 1.0E-11
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 647 867 1.0E-11
sp|E3WDQ9|PUM2_XENLA Pumilio homolog 2 OS=Xenopus laevis GN=pum2 PE=1 SV=1 647 867 2.0E-11
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 647 867 3.0E-11
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 647 867 5.0E-11
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 647 882 6.0E-11
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 647 867 7.0E-11
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 647 882 9.0E-11
sp|O94462|PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf3 PE=2 SV=4 662 872 2.0E-10
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 633 835 3.0E-10
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 633 846 5.0E-10
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 633 803 5.0E-10
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 633 835 5.0E-10
sp|Q07807|PUF3_YEAST mRNA-binding protein PUF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF3 PE=1 SV=1 645 860 8.0E-10
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 633 835 9.0E-10
sp|P39016|MPT5_YEAST Suppressor protein MPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPT5 PE=1 SV=2 658 824 1.0E-09
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 633 835 1.0E-09
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 633 835 1.0E-09
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 630 872 3.0E-09
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 633 836 4.0E-09
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 446 524 2.0E-07
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 434 539 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7945
Ophiocordyceps camponoti-floridani Ophcf2|06480
Ophiocordyceps camponoti-rufipedis Ophun1|1610
Ophiocordyceps camponoti-rufipedis Ophun1|2376
Ophiocordyceps kimflemingae Ophio5|8585
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5945
MAPAYSTRHSASQNSSQPSAHSTSAAEASGPLPSGPLSRSAFGLAGAINHNGIMAANSRSGAGSPSHELAGSSRL
FSKRAREIQAQEGIPGLPINPWGGPPTSGNSTPLRENIPESPTDGFPDFGQLPTPESLPQTRRARAGTVPSRFSP
GGPANGLLNVPNIAPVSTRATPSQTPYNKSPSPSFEHTENTSSGSTLLSRLRAGSMPQRSPFHSMTSTASPFGPS
IFSSNWNPAGVGRERASTLASIASIGSNGPSSPAQSQFSREGGGESNVHMRTLDYLGLAETPQPPRAQLATPYLA
NMAYSTQPSRFRSYSVNNKDKYADDEDEYEDYAAVLQDQLAATQAAIHNHNLAVQAFVNQASATRPRAHTAGVLD
APGSRFVPTYAGPGSGAPSNMASAGGEMRVADNHEYEDIAQAMAGVSIGRCMSRNAGLLSAEEQGLEGPTSALWL
GGVPTSTTTSTLTEMFKAHGPILSARVLTHKNCGFVNFEKVESAMSAKNSLNGKEIFPGAGPIRINFAKPPSASN
TPGPDGVFPSPSPDPFGKGGQDGGHSAASAGPSGQAAGLASASTGAPRLGEMMADIADIVVQFGATEDDKSQISR
SVTSALHYQGYAEEIPPIREPSQTRLHDAPRLRDIRKRIDNQLMPQAEIESVAMDMLPEIAELSSDYLGNTVVQK
LFEHCSDAVRDAMLEKVAPHLAEIGVHKNGTWAAQKIIDVCKTPSQMSTIVEHLRPYTVPLFLDQYGNYVLQGCL
KFGPPYNDFIFEAMLSRLWDIAQGRFGARAMRACLESHHASKNQQRMLAAAIALNSVPLATNANGALLLTWLLDT
CTFPQRRTVLSPRLEPCLVHLCTHKVAYLTVLKVINQKAEADARDAMLRAMFFSPNDQVLEAILSDHSCGATLIF
KVLTTPFFDDRIRAQVVENVKRVLCNIKAQPNQGYKRLMDEVGLSTRAPASSRDGNASSEPRQRPAPRQGGSNAQ
HAHGKQPYFNANAVNPAVSAGAFDAGYGVARSDSTEASLAGFPAYGQGLVYNAAAPATVNPAMNLQHLQYQQSLM
ARGTPQMNYPFPIQAGYGPYGAPAATVDHYRQQNVANGTPVQMPSPQLSHMAPSQPSYGQAGFGVPMGGAFGYGN
VGAMQAINYMHQEPNNSNTNSNNAPANSQHHNTHNNHNNSNSRRGRVR*
Coding >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCT
CCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCCCAGAGTCTCCAACCGACGGATTCCCCGACTTTGGT
CAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAGCAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCC
GGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTGCCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACA
CCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTGAAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGG
CTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATTCCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCA
ATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTGAAAGAGCATCCACTCTTGCCAGTATTGCTAGCATT
GGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATG
CGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGCCTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCA
AACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTTATTCAGTCAACAACAAGGACAAGTATGCAGATGAC
GAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACCAACTGGCTGCCACACAGGCGGCCATCCACAACCAC
AACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGAC
GCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCGGCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGG
GGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACATTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGA
TGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGCAAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTT
GGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTGAGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCC
CGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTGAAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGT
CTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTCGCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAAC
ACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCAC
AGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGCTGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGT
GAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTGGGGCAACTGAGGACGACAAGAGCCAGATCAGCCGC
AGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGG
CTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATTGAA
AGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCTCGTCTGACTACCTGGGCAACACTGTGGTGCAGAAA
CTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGCTGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGC
GTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTGACGTTTGCAAGACGCCGAGCCAAATGTCCACCATT
GTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGGACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTC
AAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGATGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGC
TTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACCATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCC
GCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCAATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACG
TGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCCTGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAG
GTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGGCCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCC
ATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCCTGAGCGACCATTCGTGTGGCGCAACGCTCATCTTC
AAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGGCCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGC
AACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCATGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCG
TCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGCGCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAG
CATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCGTGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCC
GGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTTTGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTG
TACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGAATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATG
GCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTCAAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCC
ACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCACTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCAC
ATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTGGAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAAC
GTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGCCCAACAATAGCAATACCAACAGCAACAATGCCCCG
GCCAATAGTCAGCATCACAACACGCACAACAATCACAACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Transcript >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCT
CCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCCCAGAGTCTCCAACCGACGGATTCCCCGACTTTGGT
CAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAGCAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCC
GGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTGCCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACA
CCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTGAAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGG
CTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATTCCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCA
ATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTGAAAGAGCATCCACTCTTGCCAGTATTGCTAGCATT
GGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATG
CGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGCCTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCA
AACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTTATTCAGTCAACAACAAGGACAAGTATGCAGATGAC
GAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACCAACTGGCTGCCACACAGGCGGCCATCCACAACCAC
AACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGAC
GCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCGGCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGG
GGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACATTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGA
TGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGCAAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTT
GGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTGAGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCC
CGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTGAAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGT
CTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTCGCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAAC
ACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCAC
AGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGCTGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGT
GAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTGGGGCAACTGAGGACGACAAGAGCCAGATCAGCCGC
AGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGG
CTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATTGAA
AGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCTCGTCTGACTACCTGGGCAACACTGTGGTGCAGAAA
CTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGCTGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGC
GTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTGACGTTTGCAAGACGCCGAGCCAAATGTCCACCATT
GTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGGACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTC
AAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGATGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGC
TTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACCATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCC
GCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCAATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACG
TGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCCTGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAG
GTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGGCCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCC
ATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCCTGAGCGACCATTCGTGTGGCGCAACGCTCATCTTC
AAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGGCCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGC
AACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCATGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCG
TCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGCGCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAG
CATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCGTGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCC
GGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTTTGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTG
TACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGAATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATG
GCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTCAAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCC
ACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCACTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCAC
ATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTGGAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAAC
GTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGCCCAACAATAGCAATACCAACAGCAACAATGCCCCG
GCCAATAGTCAGCATCACAACACGCACAACAATCACAACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Gene >OphauG2|5945
ATGGCTCCCGCATATTCGACTCGTCATAGCGCCTCTCAGAACAGTTCACAACCATCAGCCCACAGCACTTCGGCT
GCTGAAGCCTCGGGGCCTCTACCCTCGGGGCCTCTTTCCAGATCCGCCTTTGGACTCGCAGGTGCTATTAATCAT
AACGGCATCATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGCTGGCTGGATCGAGCCGCCTC
TTTTCCAAAAGGTTTGTGCCTGCATATTTGAATTTTTAGTTTTTGGAGGCGCTTTCAACCTATGCTCTATTCAGC
CAATGCTGACGCGTGTTTGTTTTTTGTTTTTTTTCCTTGTTGTCAGAGCACGCGAGATTCAGGCTCAAGAAGGCA
TTCCCGGCCTGCCCATCAATCCATGGGGCGGTCCTCCTACGAGCGGCAACTCAACGCCCTTACGCGAGAATATCC
CAGAGTCTCCAACCGACGGATTCCCCGACTTTGGTCAGTTGCCCACTCCCGAGAGCTTGCCTCAGACTCGCCGAG
CAAGAGCTGGCACAGTTCCTTCGCGTTTTTCTCCCGGCGGCCCTGCCAACGGCCTGTTGAACGTGCCAAACATTG
CCCCCGTCTCTACCAGGGCTACCCCCTCTCAAACACCTTATAACAAATCCCCATCTCCTAGTTTTGAACACACTG
AAAACACGTCGAGCGGCTCCACGCTTTTGTCGCGGCTGAGGGCCGGGTCTATGCCACAGCGAAGTCCGTTTCATT
CCATGACGAGTACTGCTTCTCCTTTTGGGCCTTCAATTTTTAGTAGTAACTGGAATCCAGCGGGCGTGGGCCGTG
AAAGAGCATCCACTCTTGCCAGTATTGCTAGCATTGGTTCCAACGGACCCAGTTCTCCAGCGCAGTCACAATTCT
CGAGAGAAGGTGGCGGAGAGTCCAATGTTCATATGCGCACGCTTGACTATCTTGGACTTGCAGAGACACCCCAGC
CTCCAAGAGCTCAACTAGCAACCCCCTACCTGGCAAACATGGCTTATTCAACGCAGCCAAGCCGCTTTCGGTCTT
ATTCAGTCAACAACAAGGACAAGTATGCAGATGACGAGGACGAGTATGAAGACTATGCGGCTGTGCTACAAGACC
AACTGGCTGCCACACAGGCGGCCATCCACAACCACAACTTGGCTGTGCAGGCTTTTGTCAATCAGGCATCTGCCA
CGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGACGCGCCTGGAAGTCGCTTCGTGCCCACGTATGCCGGCCCCG
GCTCGGGGGCGCCCAGCAACATGGCGTCAGCCGGGGGCGAGATGCGTGTAGCGGACAACCACGAGTATGAGGACA
TTGCCCAGGCCATGGCAGGCGTGAGCATTGGGAGATGTATGAGCCGCAACGCGGGCCTCTTGAGCGCCGAGGAGC
AAGGGCTGGAAGGCCCAACGAGTGCCCTGTGGCTTGGAGGAGTGCCAACGTCAACGACGACATCGACGCTGACTG
AGATGTTCAAGGCGCATGGCCCCATTTTGTCTGCCCGCGTTCTCACGCACAAGAATTGCGGCTTTGTGAATTTTG
AAAAGGTTGAGAGCGCCATGTCTGCAAAGAACAGTCTCAACGGCAAGGAGATTTTCCCTGGGGCCGGTCCCATTC
GCATCAATTTTGCCAAGCCGCCTTCGGCGTCCAACACTCCTGGTCCTGATGGCGTGTTCCCTTCGCCCAGCCCAG
ATCCCTTTGGCAAAGGAGGCCAAGATGGAGGCCACAGTGCCGCCTCTGCTGGCCCGTCGGGACAGGCCGCGGGGC
TGGCCAGTGCAAGCACAGGGGCACCACGGCTGGGTGAAATGATGGCGGACATTGCGGACATTGTGGTGCAGTTTG
GGGCAACTGAGGACGACAAGAGCCAGATCAGCCGCAGCGTCACGTCTGCCCTTCACTACCAGGGCTATGCCGAGG
AGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGGCTCCACGACGCTCCCCGGCTCAGAGACATCCGCAAGCGCA
TTGACAATCAGCTGATGCCGCAAGCCGAGATTGAAAGCGTGGCCATGGACATGCTGCCAGAGATTGCCGAGCTCT
CGTCTGACTACCTGGGCAACACTGTGGTGCAGAAACTGTTTGAGCACTGCTCGGACGCGGTGCGGGATGCCATGC
TGGAAAAGGTTGCGCCACACTTGGCTGAGATTGGCGTGCACAAGAATGGCACCTGGGCAGCGCAAAAGATTATTG
ACGTTTGCAAGACGCCGAGCCAAATGTCCACCATTGTCGAGCACCTGCGGCCGTACACGGTGCCTCTGTTCTTGG
ACCAGTACGGCAACTATGTCTTGCAAGGGTGCCTCAAGTTTGGGCCGCCCTACAACGACTTCATCTTTGAGGCGA
TGCTCAGCCGCCTGTGGGACATTGCCCAAGGCCGCTTTGGCGCGCGGGCCATGAGGGCTTGTCTGGAGAGCCACC
ATGCCAGCAAGAACCAGCAGCGCATGCTGGCAGCCGCCATTGCGCTCAACAGCGTCCCGCTGGCCACCAATGCCA
ATGGCGCGCTGCTTCTCACCTGGCTGCTTGACACGTGCACCTTTCCTCAGCGACGCACCGTCTTGTCTCCTCGCC
TGGAGCCGTGCCTCGTCCACCTCTGCACCCACAAGGTGGCATATCTGACTGTCCTCAAGGTGATTAATCAAAAGG
CCGAGGCGGATGCTCGTGATGCCATGCTCAGGGCCATGTTCTTCTCCCCCAACGACCAGGTTCTCGAGGCAATCC
TGAGCGACCATTCGTGTGGCGCAACGCTCATCTTCAAGGTGCTCACGACGCCCTTTTTCGACGACAGAATTAGGG
CCCAGGTTGTGGAAAATGTGAAGCGCGTTCTATGCAACATCAAGGCCCAGCCCAACCAAGGCTACAAGCGCCTCA
TGGACGAGGTTGGTCTTTCCACCAGGGCGCCAGCGTCAAGCCGCGATGGCAACGCGTCTTCAGAGCCGCGCCAGC
GCCCCGCCCCGCGGCAAGGCGGCTCCAACGCCCAGCATGCCCATGGCAAGCAGCCCTACTTCAATGCCAACGCCG
TGAACCCTGCTGTCAGTGCAGGGGCCTTTGATGCCGGCTACGGCGTCGCCAGAAGCGACAGCACTGAAGCCAGTT
TGGCTGGTTTCCCGGCCTATGGCCAGGGCCTTGTGTACAACGCCGCTGCTCCAGCCACGGTCAACCCGGCCATGA
ATTTGCAGCATTTGCAGTACCAGCAGAGCTTGATGGCCAGGGGCACGCCGCAGATGAACTACCCCTTTCCCATTC
AAGCCGGCTATGGCCCCTATGGCGCTCCAGCCGCCACGGTTGACCACTATCGCCAGCAAAATGTAGCCAATGGCA
CTCCTGTGCAGATGCCGTCGCCCCAGCTCTCTCACATGGCGCCCAGCCAGCCCTCGTACGGCCAAGCTGGCTTTG
GAGTGCCCATGGGAGGGGCCTTTGGCTATGGAAACGTTGGCGCCATGCAAGCCATCAACTACATGCACCAAGAGC
CCAACAATAGCAATACCAACAGCAACAATGCCCCGGCCAATAGTCAGCATCACAACACGCACAACAATCACAACA
ACAGTAATTCTAGGCGCGGTCGGGTACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail