Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5939
Gene name
LocationContig_579:4549..5019
Strand+
Gene length (bp)470
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 5.4E-07 31 79

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P91664|MAX_DROME Protein max OS=Drosophila melanogaster GN=Max PE=1 SV=1 26 94 1.0E-06

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5939
MASPNNNASMSPGEGALAVPEEKPRLTEEEKKQNHIASEQKRRQAIREGFDRLTELVPGLEGQGRSEGLVLKRTV
EFMRLQLDERRALIERIEKAGGHVDEDVKGSVGVESHNRVKS*
Coding >OphauG2|5939
ATGGCGTCGCCCAACAACAATGCATCAATGTCGCCAGGCGAGGGTGCCTTGGCTGTGCCCGAGGAGAAGCCGCGG
CTGACCGAGGAGGAAAAGAAGCAAAACCACATTGCCTCTGAGCAGAAGCGCAGACAGGCCATTCGCGAGGGCTTT
GACCGCCTGACAGAGCTGGTGCCCGGGCTCGAAGGCCAGGGCCGGTCCGAAGGCCTCGTTCTCAAGCGCACCGTT
GAGTTTATGCGCCTGCAGCTCGACGAGCGCCGCGCTCTCATTGAGCGCATTGAAAAGGCGGGCGGCCACGTCGAC
GAGGATGTCAAAGGGTCTGTTGGTGTAGAGAGCCACAACCGTGTCAAGAGCTGA
Transcript >OphauG2|5939
ATGGCGTCGCCCAACAACAATGCATCAATGTCGCCAGGCGAGGGTGCCTTGGCTGTGCCCGAGGAGAAGCCGCGG
CTGACCGAGGAGGAAAAGAAGCAAAACCACATTGCCTCTGAGCAGAAGCGCAGACAGGCCATTCGCGAGGGCTTT
GACCGCCTGACAGAGCTGGTGCCCGGGCTCGAAGGCCAGGGCCGGTCCGAAGGCCTCGTTCTCAAGCGCACCGTT
GAGTTTATGCGCCTGCAGCTCGACGAGCGCCGCGCTCTCATTGAGCGCATTGAAAAGGCGGGCGGCCACGTCGAC
GAGGATGTCAAAGGGTCTGTTGGTGTAGAGAGCCACAACCGTGTCAAGAGCTGA
Gene >OphauG2|5939
ATGGCGTCGCCCAACAACAATGCATCAATGTCGCCAGGCGAGGGTGCCTTGGCTGTGCCCGAGGAGAAGCCGCGG
CTGACCGAGGAGGAAAAGAAGCAAAACCACATTGCCTCTGGTACAGAGAGCCGCATGTCGCCACGCACCCCCCGA
CTTGCGCTTACATGTCCTTGACAGAGCAGAAGCGCAGACAGGCCATTCGCGAGGGCTTTGACCGCCTGACAGAGC
TGGTGCCCGGGCTCGAAGGCCAGGGCCGGTCCGAAGGCCTCGTTCTCAAGCGCACCGTTGAGTTTATGCGCCTGC
AGCTCGACGAGCGCCGCGCTCTCATTGAGCGCATTGAAAAGGCGGGCGGCCACGTCGACGAGGATGTCAAAGGGT
TTGTCCTTGCTGCCCCCAAACATGGCCCAGTTGCAGCTGACAGTGCGCGCCCTAGGTCTGTTGGTGTAGAGAGCC
ACAACCGTGTCAAGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail