Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5932
Gene name
LocationContig_577:9518..11393
Strand-
Gene length (bp)1875
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 5.6E-46 215 499
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 2.7E-40 62 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 46 601 0.0E+00
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 53 258 5.0E-64
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 359 599 7.0E-62
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 358 572 2.0E-54
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 20 256 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 46 601 0.0E+00
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 53 258 5.0E-64
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 359 599 7.0E-62
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 358 572 2.0E-54
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 20 256 2.0E-47
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 53 253 1.0E-41
sp|Q10713|MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens GN=PMPCA PE=1 SV=2 53 253 3.0E-41
sp|Q0P5M8|MPPA_BOVIN Mitochondrial-processing peptidase subunit alpha OS=Bos taurus GN=PMPCA PE=2 SV=1 53 253 2.0E-40
sp|Q9DC61|MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus GN=Pmpca PE=1 SV=1 53 253 3.0E-40
sp|P20069|MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus GN=Pmpca PE=1 SV=1 53 253 7.0E-40
sp|P97997|MPPA_BLAEM Mitochondrial-processing peptidase subunit alpha OS=Blastocladiella emersonii PE=3 SV=1 342 554 3.0E-37
sp|P97997|MPPA_BLAEM Mitochondrial-processing peptidase subunit alpha OS=Blastocladiella emersonii PE=3 SV=1 54 253 1.0E-35
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 53 255 4.0E-33
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 53 255 2.0E-32
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 47 256 6.0E-32
sp|Q9DC61|MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus GN=Pmpca PE=1 SV=1 351 556 1.0E-31
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 53 255 1.0E-31
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 53 255 1.0E-31
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 12 258 1.0E-31
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 53 255 4.0E-31
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 47 256 8.0E-31
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 47 256 3.0E-30
sp|Q10713|MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens GN=PMPCA PE=1 SV=2 351 556 1.0E-29
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 351 556 2.0E-29
sp|Q00302|MPPB_BLAEM Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1 53 256 5.0E-29
sp|Q9P7X1|MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr1 PE=2 SV=1 53 257 6.0E-29
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 53 256 1.0E-28
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 53 259 2.0E-28
sp|Q0P5M8|MPPA_BOVIN Mitochondrial-processing peptidase subunit alpha OS=Bos taurus GN=PMPCA PE=2 SV=1 359 556 4.0E-28
sp|Q4W6B5|MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum GN=mppB PE=1 SV=1 47 257 7.0E-28
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 53 269 8.0E-28
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 12 253 9.0E-28
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 57 254 5.0E-27
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 12 262 1.0E-26
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 53 256 3.0E-26
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 28 253 3.0E-26
sp|P20069|MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus GN=Pmpca PE=1 SV=1 395 556 6.0E-26
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 379 554 5.0E-24
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 53 269 1.0E-23
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 379 554 2.0E-23
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 381 553 1.0E-22
sp|Q04805|YMXG_BACSU Uncharacterized zinc protease YmxG OS=Bacillus subtilis (strain 168) GN=ymxG PE=3 SV=3 59 258 1.0E-21
sp|P0A5S9|Y2805_MYCBO Uncharacterized zinc protease Mb2805c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2805c PE=3 SV=1 55 254 1.0E-21
sp|P9WHT5|Y2782_MYCTU Uncharacterized zinc protease Rv2782c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2782c PE=1 SV=1 55 254 1.0E-21
sp|O32965|Y855_MYCLE Uncharacterized zinc protease ML0855 OS=Mycobacterium leprae (strain TN) GN=ML0855 PE=3 SV=1 55 254 1.0E-21
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 54 266 5.0E-21
sp|P9WHT4|Y2782_MYCTO Uncharacterized zinc protease MT2852 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2852 PE=3 SV=1 55 254 1.0E-20
sp|P98080|UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans GN=ucr-1 PE=3 SV=2 53 256 1.0E-20
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 53 257 4.0E-20
sp|Q92IX7|Y293_RICCN Uncharacterized zinc protease RC0293 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0293 PE=3 SV=1 54 257 2.0E-19
sp|O05945|Y219_RICPR Uncharacterized zinc protease RP219 OS=Rickettsia prowazekii (strain Madrid E) GN=RP219 PE=3 SV=1 53 257 2.0E-19
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 43 253 4.0E-19
sp|Q68XF0|Y210_RICTY Uncharacterized zinc protease RT0210 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0210 PE=3 SV=1 54 257 6.0E-19
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 43 253 9.0E-19
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 347 556 1.0E-17
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 32 253 1.0E-16
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 358 586 3.0E-15
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 358 554 3.0E-15
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 53 303 3.0E-15
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 358 586 4.0E-15
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 358 556 1.0E-14
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 55 253 2.0E-14
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 381 569 2.0E-14
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 358 586 5.0E-14
sp|Q9P7X1|MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr1 PE=2 SV=1 382 556 9.0E-14
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 352 556 1.0E-13
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 373 554 5.0E-13
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 394 552 7.0E-13
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 358 565 8.0E-13
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 44 282 1.0E-12
sp|Q92IX7|Y293_RICCN Uncharacterized zinc protease RC0293 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0293 PE=3 SV=1 358 555 2.0E-12
sp|Q4W6B5|MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum GN=mppB PE=1 SV=1 380 553 3.0E-12
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 347 551 5.0E-12
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 40 254 5.0E-12
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 371 575 1.0E-11
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 382 556 2.0E-11
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 60 269 2.0E-11
sp|Q00302|MPPB_BLAEM Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1 346 553 8.0E-11
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 376 556 1.0E-09
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 376 556 1.0E-09
sp|Q5UPX9|YL233_MIMIV Putative zinc protease L233 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L233 PE=3 SV=1 53 239 1.0E-09
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 376 556 2.0E-09
sp|Q6FSJ3|QCR2_CANGA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR2 PE=3 SV=1 63 243 2.0E-09
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 376 556 4.0E-09
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 358 551 5.0E-09
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 358 551 7.0E-09
sp|Q6CWJ6|QCR2_KLULA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR2 PE=3 SV=1 70 243 3.0E-08
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 358 551 4.0E-08
sp|O05945|Y219_RICPR Uncharacterized zinc protease RP219 OS=Rickettsia prowazekii (strain Madrid E) GN=RP219 PE=3 SV=1 358 555 4.0E-08
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 380 553 1.0E-07
sp|Q68XF0|Y210_RICTY Uncharacterized zinc protease RT0210 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0210 PE=3 SV=1 358 555 1.0E-07
sp|P07256|QCR1_YEAST Cytochrome b-c1 complex subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COR1 PE=1 SV=1 355 549 1.0E-07
sp|P0A5S9|Y2805_MYCBO Uncharacterized zinc protease Mb2805c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2805c PE=3 SV=1 358 554 3.0E-07
sp|P9WHT5|Y2782_MYCTU Uncharacterized zinc protease Rv2782c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2782c PE=1 SV=1 358 554 3.0E-07
sp|O32965|Y855_MYCLE Uncharacterized zinc protease ML0855 OS=Mycobacterium leprae (strain TN) GN=ML0855 PE=3 SV=1 358 553 3.0E-07
sp|P9WHT4|Y2782_MYCTO Uncharacterized zinc protease MT2852 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2852 PE=3 SV=1 358 554 3.0E-07
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 77 256 5.0E-07
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 60 169 5.0E-07
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 358 553 6.0E-07
sp|P07257|QCR2_YEAST Cytochrome b-c1 complex subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR2 PE=1 SV=1 61 175 7.0E-07
sp|Q04805|YMXG_BACSU Uncharacterized zinc protease YmxG OS=Bacillus subtilis (strain 168) GN=ymxG PE=3 SV=3 378 548 1.0E-06
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 61 243 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2562
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5932 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|759
Ophiocordyceps camponoti-floridani Ophcf2|05994
Ophiocordyceps camponoti-rufipedis Ophun1|422
Ophiocordyceps kimflemingae Ophio5|5684
Ophiocordyceps subramaniannii Hirsu2|3810

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5932
MLRQFSTRLQPRLAASPAQLLRRRGLGLAAPAWRSMATVNVEGIPKDPAELDQVTRLSNGLRVASEALPGSFSGV
GVYIEAGSRYEDESLRGVSHIIDRLAFKSTSRYSADEMLERVEALGGNIQCASSRECIMYQAASFNRAVPDTVAL
LAETIRDARFTDTEVSQQLETARYEIDEIWGNSELILPELLHMAAYKDNTLGNPLLCPREKLETIDRNTVMAYRK
LFYRPDRMIVAFAGVDHSTAVDLAQQYFGDMKADDSVFSTASSRRASESSDSTSSSSSSSSSSSSSSSSSSTSSS
SVSSSSPSSAPVTHQPPRSKIISRIPFFKNLSTSAPQNATVANTLLPNSLADIDLSQPAHYTGGFLSLPGRTLPA
NATQLTHVLLAFEGVPVGSDDVYAVATLQILLGGGGSFSAGGPGKGMYSRLYTNVLNQYSWVESCTAFNHSYTDS
GLFGICGSCVPGNIQAMFEVMSQELRALTLERHHTRLQEVEVERAKKQLRSSLLMNLESRMVELEDLGRSVQIHG
RKVPVRDMCRRIESLTVADLRRVATEIMAGKVVNPGRGSGAPSVVVQEGKGYKHLTTDFGWEQMQDVIATWQLGR
R*
Coding >OphauG2|5932
ATGTTGCGCCAGTTCAGCACCCGGCTGCAACCCAGACTGGCTGCCTCGCCAGCACAGCTGCTCCGGCGGCGCGGC
CTGGGCTTGGCCGCTCCGGCTTGGAGGAGCATGGCAACGGTCAATGTCGAAGGCATCCCCAAGGACCCCGCAGAG
CTCGACCAAGTGACTCGGCTATCCAACGGGCTCCGTGTGGCGTCGGAAGCGCTCCCAGGCTCCTTTTCCGGCGTG
GGCGTCTACATCGAGGCCGGGTCACGCTATGAAGACGAGTCACTGCGAGGCGTGTCGCATATTATTGACCGCCTG
GCATTCAAGTCGACATCGCGCTACTCTGCAGATGAAATGCTGGAGCGTGTCGAGGCCCTGGGTGGCAATATCCAG
TGCGCCTCGTCTCGCGAGTGCATCATGTATCAGGCAGCTTCTTTCAACCGTGCGGTGCCCGATACCGTCGCTCTC
CTTGCAGAGACGATTCGCGATGCACGCTTTACAGACACAGAGGTGTCGCAGCAGCTCGAGACTGCGCGATATGAG
ATTGATGAGATATGGGGCAATTCTGAACTCATCTTGCCCGAGCTGCTGCACATGGCCGCCTACAAGGACAATACA
CTGGGCAACCCGCTCCTATGTCCAAGGGAGAAGCTGGAGACCATAGACCGCAACACCGTCATGGCTTATCGAAAA
TTATTTTATAGACCCGACCGAATGATTGTGGCGTTTGCTGGTGTCGACCACAGCACCGCTGTTGATTTGGCTCAA
CAGTATTTTGGCGACATGAAGGCTGACGACTCGGTTTTTTCGACAGCCTCGTCAAGGAGGGCATCAGAATCAAGC
GACAGCACATCATCATCATCATCATCATCCTCATCATCGTCATCGTCATCGTCATCATCATCTACTTCTTCCTCT
TCCGTCTCTTCGTCTTCACCCTCTTCAGCACCCGTTACTCACCAGCCACCTCGATCAAAAATCATTTCCCGCATT
CCATTTTTTAAGAATCTCTCCACATCGGCGCCTCAAAACGCTACCGTGGCCAATACTCTGCTTCCAAATTCACTC
GCAGACATTGATTTGAGCCAGCCGGCCCACTACACGGGTGGTTTCTTGTCCCTCCCAGGACGAACGTTGCCGGCG
AATGCCACGCAACTCACACACGTCTTGTTAGCATTCGAGGGCGTTCCAGTTGGCTCTGACGACGTATACGCCGTT
GCAACGCTACAAATCTTGCTCGGCGGCGGCGGTTCCTTTTCTGCCGGCGGACCAGGAAAGGGTATGTACTCTCGA
CTATACACAAACGTGCTCAACCAGTATAGTTGGGTGGAATCGTGCACCGCGTTCAACCACTCATACACCGACTCG
GGCCTCTTTGGCATTTGCGGGTCGTGTGTGCCAGGCAACATTCAGGCCATGTTTGAAGTGATGAGCCAAGAGCTC
AGGGCGCTGACGCTGGAGCGTCACCACACACGCCTTCAAGAGGTCGAGGTGGAGCGGGCCAAGAAGCAGCTGCGC
AGTAGCCTTCTCATGAATCTCGAAAGCCGCATGGTGGAGCTTGAAGACTTGGGGCGGTCGGTGCAGATTCACGGG
CGCAAGGTGCCGGTGCGTGACATGTGCCGTCGCATCGAGTCGCTGACGGTGGCCGACTTGAGGCGCGTGGCGACG
GAAATCATGGCGGGCAAGGTGGTGAATCCAGGCCGCGGCAGCGGGGCGCCGTCAGTGGTGGTACAGGAGGGGAAG
GGATATAAGCACCTCACTACGGACTTTGGATGGGAACAGATGCAGGATGTCATAGCGACATGGCAACTTGGCAGG
AGATAG
Transcript >OphauG2|5932
ATGTTGCGCCAGTTCAGCACCCGGCTGCAACCCAGACTGGCTGCCTCGCCAGCACAGCTGCTCCGGCGGCGCGGC
CTGGGCTTGGCCGCTCCGGCTTGGAGGAGCATGGCAACGGTCAATGTCGAAGGCATCCCCAAGGACCCCGCAGAG
CTCGACCAAGTGACTCGGCTATCCAACGGGCTCCGTGTGGCGTCGGAAGCGCTCCCAGGCTCCTTTTCCGGCGTG
GGCGTCTACATCGAGGCCGGGTCACGCTATGAAGACGAGTCACTGCGAGGCGTGTCGCATATTATTGACCGCCTG
GCATTCAAGTCGACATCGCGCTACTCTGCAGATGAAATGCTGGAGCGTGTCGAGGCCCTGGGTGGCAATATCCAG
TGCGCCTCGTCTCGCGAGTGCATCATGTATCAGGCAGCTTCTTTCAACCGTGCGGTGCCCGATACCGTCGCTCTC
CTTGCAGAGACGATTCGCGATGCACGCTTTACAGACACAGAGGTGTCGCAGCAGCTCGAGACTGCGCGATATGAG
ATTGATGAGATATGGGGCAATTCTGAACTCATCTTGCCCGAGCTGCTGCACATGGCCGCCTACAAGGACAATACA
CTGGGCAACCCGCTCCTATGTCCAAGGGAGAAGCTGGAGACCATAGACCGCAACACCGTCATGGCTTATCGAAAA
TTATTTTATAGACCCGACCGAATGATTGTGGCGTTTGCTGGTGTCGACCACAGCACCGCTGTTGATTTGGCTCAA
CAGTATTTTGGCGACATGAAGGCTGACGACTCGGTTTTTTCGACAGCCTCGTCAAGGAGGGCATCAGAATCAAGC
GACAGCACATCATCATCATCATCATCATCCTCATCATCGTCATCGTCATCGTCATCATCATCTACTTCTTCCTCT
TCCGTCTCTTCGTCTTCACCCTCTTCAGCACCCGTTACTCACCAGCCACCTCGATCAAAAATCATTTCCCGCATT
CCATTTTTTAAGAATCTCTCCACATCGGCGCCTCAAAACGCTACCGTGGCCAATACTCTGCTTCCAAATTCACTC
GCAGACATTGATTTGAGCCAGCCGGCCCACTACACGGGTGGTTTCTTGTCCCTCCCAGGACGAACGTTGCCGGCG
AATGCCACGCAACTCACACACGTCTTGTTAGCATTCGAGGGCGTTCCAGTTGGCTCTGACGACGTATACGCCGTT
GCAACGCTACAAATCTTGCTCGGCGGCGGCGGTTCCTTTTCTGCCGGCGGACCAGGAAAGGGTATGTACTCTCGA
CTATACACAAACGTGCTCAACCAGTATAGTTGGGTGGAATCGTGCACCGCGTTCAACCACTCATACACCGACTCG
GGCCTCTTTGGCATTTGCGGGTCGTGTGTGCCAGGCAACATTCAGGCCATGTTTGAAGTGATGAGCCAAGAGCTC
AGGGCGCTGACGCTGGAGCGTCACCACACACGCCTTCAAGAGGTCGAGGTGGAGCGGGCCAAGAAGCAGCTGCGC
AGTAGCCTTCTCATGAATCTCGAAAGCCGCATGGTGGAGCTTGAAGACTTGGGGCGGTCGGTGCAGATTCACGGG
CGCAAGGTGCCGGTGCGTGACATGTGCCGTCGCATCGAGTCGCTGACGGTGGCCGACTTGAGGCGCGTGGCGACG
GAAATCATGGCGGGCAAGGTGGTGAATCCAGGCCGCGGCAGCGGGGCGCCGTCAGTGGTGGTACAGGAGGGGAAG
GGATATAAGCACCTCACTACGGACTTTGGATGGGAACAGATGCAGGATGTCATAGCGACATGGCAACTTGGCAGG
AGATAG
Gene >OphauG2|5932
ATGTTGCGCCAGTTCAGCACCCGGCTGCAACCCAGACTGGCTGCCTCGCCAGCACAGCTGCTCCGGCGGCGCGGC
CTGGGCTTGGCCGCTCCGGCTTGGAGGAGCATGGCAACGGTCAATGTCGAAGGCATCCCCAAGGTCCGATTCTTG
CCCTCATGCCATTTTGCCTGCTTCTTTACCCTGTGCTAACGTCTCATCTGTCCACAGGACCCCGCAGAGCTCGAC
CAAGTGACTCGGCTATCCAACGGGCTCCGTGTGGCGTCGGAAGCGCTCCCAGGCTCCTTTTCCGGCGTGGGCGTC
TACATCGAGGCCGGGTCACGCTATGAAGACGAGTCACTGCGAGGCGTGTCGCATATTATTGACCGCCTGGCATTC
AAGTCGACATCGCGCTACTCTGCAGATGAAATGCTGGAGCGTGTCGAGGCCCTGGGTGGCAATATCCAGTGCGCC
TCGTCTCGCGAGTGCATCATGTATCAGGCAGCTTCTTTCAACCGTGCGGTGCCCGATACCGTCGCTCTCCTTGCA
GAGACGATTCGCGATGCACGCTTTACAGACACAGAGGTGTCGCAGCAGCTCGAGACTGCGCGATATGAGATTGAT
GAGATATGGGGCAATTCTGAACTCATCTTGCCCGAGCTGCTGCACATGGCCGCCTACAAGGACAATACACTGGGC
AACCCGCTCCTATGTCCAAGGGAGAAGCTGGAGACCATAGACCGCAACACCGTCATGGCTTATCGAAAATTATTT
TATAGACCCGACCGAATGATTGTGGCGTTTGCTGGTGTCGACCACAGCACCGCTGTTGATTTGGCTCAACAGTAT
TTTGGCGACATGAAGGCTGACGACTCGGTTTTTTCGACAGCCTCGTCAAGGAGGGCATCAGAATCAAGCGACAGC
ACATCATCATCATCATCATCATCCTCATCATCGTCATCGTCATCGTCATCATCATCTACTTCTTCCTCTTCCGTC
TCTTCGTCTTCACCCTCTTCAGCACCCGTTACTCACCAGCCACCTCGATCAAAAATCATTTCCCGCATTCCATTT
TTTAAGAATCTCTCCACATCGGCGCCTCAAAACGCTACCGTGGCCAATACTCTGCTTCCAAATTCACTCGCAGAC
ATTGATTTGAGCCAGCCGGCCCACTACACGGGTGGTTTCTTGTCCCTCCCAGGACGAACGTTGCCGGCGAATGCC
ACGCAACTCACACACGTCTTGTTAGCATTCGAGGGCGTTCCAGTTGGCTCTGACGACGTATACGCCGTTGCAACG
CTACAAATCTTGCTCGGCGGCGGCGGTTCCTTTTCTGCCGGCGGACCAGGAAAGGGTATGTACTCTCGACTATAC
ACAAACGTGCTCAACCAGTATAGTTGGGTGGAATCGTGCACCGCGTTCAACCACTCATACACCGACTCGGGCCTC
TTTGGCATTTGCGGGTCGTGTGTGCCAGGCAACATTCAGGCCATGTTTGAAGTGATGAGCCAAGAGCTCAGGGCG
CTGACGCTGGAGCGTCACCACACACGCCTTCAAGAGGTCGAGGTGGAGCGGGCCAAGAAGCAGCTGCGCAGTAGC
CTTCTCATGAATCTCGAAAGCCGCATGGTGGAGCTTGAAGACTTGGGGCGGTCGGTGCAGATTCACGGGCGCAAG
GTGCCGGTGCGTGACATGTGCCGTCGCATCGAGTCGCTGACGGTGGCCGACTTGAGGCGCGTGGCGACGGAAATC
ATGGCGGGCAAGGTGGTGAATCCAGGCCGCGGCAGCGGGGCGCCGTCAGTGGTGGTACAGGAGGGGAAGGGATAT
AAGCACCTCACTACGGACTTTGGATGGGAACAGATGCAGGATGTCATAGCGACATGGCAACTTGGCAGGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail