Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|593
Gene name
LocationContig_1141:2182..5515
Strand+
Gene length (bp)3333
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19326 AMP_deaminase AMP deaminase 1.6E-290 214 854
PF00962 A_deaminase Adenosine deaminase 2.8E-11 684 813

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15274|AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMD1 PE=1 SV=2 170 857 0.0E+00
sp|O09178|AMPD3_RAT AMP deaminase 3 OS=Rattus norvegicus GN=Ampd3 PE=1 SV=2 330 853 0.0E+00
sp|O08739|AMPD3_MOUSE AMP deaminase 3 OS=Mus musculus GN=Ampd3 PE=1 SV=2 332 853 0.0E+00
sp|Q01432|AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens GN=AMPD3 PE=1 SV=1 330 853 0.0E+00
sp|Q84NP7|AMPD_ORYSJ Probable AMP deaminase OS=Oryza sativa subsp. japonica GN=AMPD PE=2 SV=1 332 867 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15274|AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMD1 PE=1 SV=2 170 857 0.0E+00
sp|O09178|AMPD3_RAT AMP deaminase 3 OS=Rattus norvegicus GN=Ampd3 PE=1 SV=2 330 853 0.0E+00
sp|O08739|AMPD3_MOUSE AMP deaminase 3 OS=Mus musculus GN=Ampd3 PE=1 SV=2 332 853 0.0E+00
sp|Q01432|AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens GN=AMPD3 PE=1 SV=1 330 853 0.0E+00
sp|Q84NP7|AMPD_ORYSJ Probable AMP deaminase OS=Oryza sativa subsp. japonica GN=AMPD PE=2 SV=1 332 867 0.0E+00
sp|Q54DD0|AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum GN=amdA PE=1 SV=1 331 855 0.0E+00
sp|O80452|AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana GN=AMPD PE=1 SV=2 320 842 0.0E+00
sp|Q01433|AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens GN=AMPD2 PE=1 SV=2 318 857 0.0E+00
sp|Q02356|AMPD2_RAT AMP deaminase 2 OS=Rattus norvegicus GN=Ampd2 PE=1 SV=2 318 857 0.0E+00
sp|Q9DBT5|AMPD2_MOUSE AMP deaminase 2 OS=Mus musculus GN=Ampd2 PE=1 SV=1 318 857 0.0E+00
sp|P50998|AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada1 PE=1 SV=3 209 857 0.0E+00
sp|Q3V1D3|AMPD1_MOUSE AMP deaminase 1 OS=Mus musculus GN=Ampd1 PE=1 SV=2 307 853 4.0E-177
sp|P10759|AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus GN=Ampd1 PE=1 SV=1 307 853 8.0E-176
sp|P23109|AMPD1_HUMAN AMP deaminase 1 OS=Homo sapiens GN=AMPD1 PE=1 SV=2 318 853 1.0E-173
sp|P38150|YB9Z_YEAST Inactive deaminase YBR284W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR284W PE=3 SV=1 321 849 1.0E-68
sp|P40361|YJH0_YEAST Inactive deaminase YJL070C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL070C PE=1 SV=1 230 854 3.0E-63
sp|Q4X1Q4|ADE_ASPFU Adenine deaminase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aah1 PE=3 SV=1 683 815 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019239 deaminase activity Yes
GO:0032264 IMP salvage Yes
GO:0003876 AMP deaminase activity Yes
GO:0009117 nucleotide metabolic process No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0106380 purine ribonucleotide salvage No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016787 hydrolase activity No
GO:0043101 purine-containing compound salvage No
GO:0019637 organophosphate metabolic process No
GO:0009987 cellular process No
GO:0006163 purine nucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0047623 adenosine-phosphate deaminase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0032261 purine nucleotide salvage No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0046040 IMP metabolic process No
GO:0043094 cellular metabolic compound salvage No
GO:1901564 organonitrogen compound metabolic process No
GO:0006188 IMP biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043173 nucleotide salvage No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003824 catalytic activity No
GO:0046390 ribose phosphate biosynthetic process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0003674 molecular_function No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|593
MADEATRQPGCEVDVSTKALESDDDEGSGGGPVHVMNPNGHEDEGTRQHSGGSSAVEPDDDIYQDGMLPRDVPKR
TTFYDPVAERQMTQTDAKLIYQRSKIDSRPNIPASRMQSSSTNQNQSQNQTSFHDSNSAMPWESKPATEYGPDSL
VLDSNADRSGAVEPFDRRLPILNGQVTIKGAYAGTYTAQDAKTAAQSTTILSNSSLFDTEPHITAELSSISKNIQ
KILDVRRKYITLSSQGPHDNPRDDAEWDIYPPPPEPAWVHTEAGLRKLDHQLHDCHKSADSVHNAGKRSRPDRRR
KEGLDVGEDFDMEDLQPLPGEAGMTFELDESGVYQVFNDSKQQLPSVKVPTIREFYMDLDDILTVSSDGPSKSFA
FRRLQYLEGKFNLYVLLNEYQETADSKKVPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKMKKHPNEVVLYRD
GKHLTLAEVFASINLTAYDLSIDTLDMHAHTDSFHRFDKFNLKYNPIGESRLRTIFLKTENFIHGRYLAEITKEV
ISDLESSKYQMVEWRISIYGKSIDEWDNLAAWVVDNKLFSHNVRWLVQIPRLYDVYKASGLMETFEQVVKNVFQP
LFEVTKDPSSHPKLHIFLQRVIGFDSVDDESKVERRLFKKFPVPRAWDTKQNPPYSYWIYYLFSNLTSLNYWRKK
RGFNTFVLRPHCGEAGDSEHLAVAVLSCHSISHGLLLRKVPLLQYVFYLEQIGIAMSPLSNNALFLAYERNPFHQ
YFKRGLNVSLSTDDPLQFAFTKEPLIEEYAVAAQIYKLSSVDMCELAKNSVKQSGYEASIKRQWLGPDFDKPGMA
GNTMAKTNIPDRREEFRYHTLLQERDVLRRYVIYNIDTESEVFEGSMSTNEANPPAGVVLSSVTPAQGNRGSSVS
AAEEYKFNRELEQPTEALANLHLSGSDPKIFPGIFTRDHRSSSLRNLAQAEQGPIDSNEAPEEDDDR*
Coding >OphauG2|593
ATGGCCGACGAAGCCACGCGCCAACCGGGCTGCGAGGTTGATGTTTCGACGAAGGCCCTTGAGTCGGACGACGAT
GAAGGAAGTGGCGGTGGCCCCGTGCATGTGATGAACCCCAACGGCCACGAGGATGAGGGGACCCGGCAGCATAGC
GGTGGATCGTCTGCCGTGGAACCGGACGACGACATTTACCAAGACGGCATGCTGCCACGCGATGTTCCCAAACGC
ACAACCTTTTACGACCCCGTGGCTGAGCGCCAGATGACGCAGACGGACGCAAAACTTATTTATCAACGAAGCAAG
ATCGACAGTCGGCCTAATATCCCGGCTTCTCGCATGCAATCTAGCTCTACTAATCAGAATCAATCCCAAAACCAA
ACAAGTTTCCACGACAGCAACTCCGCCATGCCTTGGGAATCCAAGCCCGCTACTGAATATGGGCCCGACTCTCTC
GTTCTAGATAGTAATGCTGACAGGTCTGGAGCTGTTGAGCCATTTGATCGTCGGCTCCCAATCTTGAATGGACAA
GTTACAATCAAGGGCGCATATGCAGGCACATATACCGCCCAAGACGCCAAAACTGCTGCACAATCGACTACCATT
CTGTCAAATAGCAGCTTATTTGACACAGAGCCACACATCACTGCCGAGCTCAGTTCTATTTCCAAGAACATCCAG
AAGATACTAGACGTCAGACGCAAGTACATCACCCTATCGTCTCAGGGGCCCCATGATAACCCTCGCGATGATGCC
GAATGGGATATTTACCCACCGCCCCCAGAGCCTGCATGGGTGCATACTGAGGCTGGCCTCAGAAAGCTTGATCAT
CAGCTGCACGACTGTCACAAGTCAGCAGACAGTGTTCATAATGCAGGGAAGAGGTCGAGACCCGACCGCAGGCGC
AAGGAGGGTCTCGATGTGGGTGAGGACTTTGATATGGAAGATCTGCAGCCACTGCCTGGCGAGGCGGGCATGACG
TTCGAGCTCGACGAGAGTGGTGTGTACCAGGTGTTTAACGACTCTAAACAACAGCTTCCTTCTGTCAAAGTTCCC
ACTATTCGCGAATTTTACATGGACTTGGATGACATCTTGACAGTATCATCCGACGGCCCTAGCAAGAGCTTCGCC
TTTCGCAGGCTGCAATACCTTGAAGGCAAATTTAACCTTTACGTCCTGCTCAATGAGTACCAGGAGACGGCCGAC
AGCAAAAAAGTTCCTCATCGCGACTTCTATAACGTGCGCAAGGTCGATACACACGTTCATCACTCGGCATGTATG
AATCAAAAGCATCTTCTGCGCTTCATCAAGAGCAAGATGAAGAAGCATCCTAATGAAGTCGTCTTGTATCGAGAT
GGAAAGCACTTGACTCTGGCAGAAGTCTTTGCCAGCATTAATTTGACTGCCTACGATCTGAGCATTGACACGCTG
GACATGCATGCACATACCGACTCTTTCCATCGTTTCGACAAGTTCAACCTTAAGTACAACCCCATTGGTGAATCC
CGTCTGAGGACAATATTCCTGAAGACGGAAAATTTCATCCACGGACGCTACCTGGCCGAGATTACCAAGGAAGTC
ATTTCAGACCTTGAGTCGAGCAAGTACCAGATGGTTGAATGGCGCATCTCGATATATGGCAAATCCATCGATGAA
TGGGACAACCTTGCGGCCTGGGTCGTGGACAACAAGCTCTTTTCACACAATGTGCGCTGGCTCGTTCAGATTCCT
CGCCTGTACGATGTGTACAAGGCAAGCGGATTGATGGAGACGTTTGAGCAGGTGGTCAAGAACGTTTTCCAGCCC
CTGTTTGAAGTAACGAAGGATCCTTCAAGCCACCCAAAACTGCATATTTTCTTGCAGCGTGTGATTGGCTTTGAT
AGTGTCGACGACGAAAGCAAGGTGGAGAGGCGACTTTTTAAGAAGTTTCCGGTACCACGGGCATGGGACACCAAG
CAAAATCCGCCTTACAGCTATTGGATCTACTATCTTTTCTCTAACTTGACCTCACTCAACTATTGGCGCAAAAAG
CGTGGGTTTAACACCTTTGTGCTACGACCTCACTGCGGCGAAGCTGGTGACAGTGAGCACTTGGCTGTTGCTGTG
CTTAGCTGCCACAGCATCAGCCATGGACTCCTGCTGCGCAAGGTCCCGCTTCTTCAATACGTCTTTTATCTAGAA
CAGATTGGCATCGCCATGTCACCTTTGAGCAATAATGCTCTGTTTCTAGCATACGAACGTAACCCTTTTCATCAG
TATTTCAAGAGGGGTCTTAATGTTTCCCTTTCGACTGATGACCCGCTTCAATTTGCCTTTACCAAGGAGCCGCTT
ATCGAAGAATATGCGGTAGCTGCACAGATTTACAAGCTCAGCTCCGTTGATATGTGTGAGTTGGCCAAAAATTCG
GTCAAGCAAAGCGGCTACGAAGCCTCGATCAAACGGCAGTGGCTTGGACCCGACTTCGACAAGCCTGGCATGGCG
GGTAACACCATGGCCAAGACCAACATTCCAGACAGGCGGGAAGAATTCCGTTATCATACTCTCCTCCAAGAGAGG
GATGTATTACGGCGCTACGTTATATATAATATAGACACGGAGTCAGAGGTGTTTGAAGGATCCATGTCAACTAAT
GAAGCCAATCCACCAGCCGGGGTAGTCTTATCTTCAGTTACGCCTGCACAAGGCAATCGTGGTAGCAGCGTCAGT
GCAGCTGAGGAGTACAAGTTCAATCGTGAACTGGAGCAGCCAACAGAGGCTCTAGCTAATCTTCATCTATCGGGA
AGTGATCCTAAAATATTTCCTGGCATCTTTACACGGGACCATCGAAGCAGTAGTTTACGCAACTTAGCACAGGCG
GAACAAGGGCCCATTGATTCAAATGAGGCACCCGAGGAAGATGATGATAGATAG
Transcript >OphauG2|593
ATGGCCGACGAAGCCACGCGCCAACCGGGCTGCGAGGTTGATGTTTCGACGAAGGCCCTTGAGTCGGACGACGAT
GAAGGAAGTGGCGGTGGCCCCGTGCATGTGATGAACCCCAACGGCCACGAGGATGAGGGGACCCGGCAGCATAGC
GGTGGATCGTCTGCCGTGGAACCGGACGACGACATTTACCAAGACGGCATGCTGCCACGCGATGTTCCCAAACGC
ACAACCTTTTACGACCCCGTGGCTGAGCGCCAGATGACGCAGACGGACGCAAAACTTATTTATCAACGAAGCAAG
ATCGACAGTCGGCCTAATATCCCGGCTTCTCGCATGCAATCTAGCTCTACTAATCAGAATCAATCCCAAAACCAA
ACAAGTTTCCACGACAGCAACTCCGCCATGCCTTGGGAATCCAAGCCCGCTACTGAATATGGGCCCGACTCTCTC
GTTCTAGATAGTAATGCTGACAGGTCTGGAGCTGTTGAGCCATTTGATCGTCGGCTCCCAATCTTGAATGGACAA
GTTACAATCAAGGGCGCATATGCAGGCACATATACCGCCCAAGACGCCAAAACTGCTGCACAATCGACTACCATT
CTGTCAAATAGCAGCTTATTTGACACAGAGCCACACATCACTGCCGAGCTCAGTTCTATTTCCAAGAACATCCAG
AAGATACTAGACGTCAGACGCAAGTACATCACCCTATCGTCTCAGGGGCCCCATGATAACCCTCGCGATGATGCC
GAATGGGATATTTACCCACCGCCCCCAGAGCCTGCATGGGTGCATACTGAGGCTGGCCTCAGAAAGCTTGATCAT
CAGCTGCACGACTGTCACAAGTCAGCAGACAGTGTTCATAATGCAGGGAAGAGGTCGAGACCCGACCGCAGGCGC
AAGGAGGGTCTCGATGTGGGTGAGGACTTTGATATGGAAGATCTGCAGCCACTGCCTGGCGAGGCGGGCATGACG
TTCGAGCTCGACGAGAGTGGTGTGTACCAGGTGTTTAACGACTCTAAACAACAGCTTCCTTCTGTCAAAGTTCCC
ACTATTCGCGAATTTTACATGGACTTGGATGACATCTTGACAGTATCATCCGACGGCCCTAGCAAGAGCTTCGCC
TTTCGCAGGCTGCAATACCTTGAAGGCAAATTTAACCTTTACGTCCTGCTCAATGAGTACCAGGAGACGGCCGAC
AGCAAAAAAGTTCCTCATCGCGACTTCTATAACGTGCGCAAGGTCGATACACACGTTCATCACTCGGCATGTATG
AATCAAAAGCATCTTCTGCGCTTCATCAAGAGCAAGATGAAGAAGCATCCTAATGAAGTCGTCTTGTATCGAGAT
GGAAAGCACTTGACTCTGGCAGAAGTCTTTGCCAGCATTAATTTGACTGCCTACGATCTGAGCATTGACACGCTG
GACATGCATGCACATACCGACTCTTTCCATCGTTTCGACAAGTTCAACCTTAAGTACAACCCCATTGGTGAATCC
CGTCTGAGGACAATATTCCTGAAGACGGAAAATTTCATCCACGGACGCTACCTGGCCGAGATTACCAAGGAAGTC
ATTTCAGACCTTGAGTCGAGCAAGTACCAGATGGTTGAATGGCGCATCTCGATATATGGCAAATCCATCGATGAA
TGGGACAACCTTGCGGCCTGGGTCGTGGACAACAAGCTCTTTTCACACAATGTGCGCTGGCTCGTTCAGATTCCT
CGCCTGTACGATGTGTACAAGGCAAGCGGATTGATGGAGACGTTTGAGCAGGTGGTCAAGAACGTTTTCCAGCCC
CTGTTTGAAGTAACGAAGGATCCTTCAAGCCACCCAAAACTGCATATTTTCTTGCAGCGTGTGATTGGCTTTGAT
AGTGTCGACGACGAAAGCAAGGTGGAGAGGCGACTTTTTAAGAAGTTTCCGGTACCACGGGCATGGGACACCAAG
CAAAATCCGCCTTACAGCTATTGGATCTACTATCTTTTCTCTAACTTGACCTCACTCAACTATTGGCGCAAAAAG
CGTGGGTTTAACACCTTTGTGCTACGACCTCACTGCGGCGAAGCTGGTGACAGTGAGCACTTGGCTGTTGCTGTG
CTTAGCTGCCACAGCATCAGCCATGGACTCCTGCTGCGCAAGGTCCCGCTTCTTCAATACGTCTTTTATCTAGAA
CAGATTGGCATCGCCATGTCACCTTTGAGCAATAATGCTCTGTTTCTAGCATACGAACGTAACCCTTTTCATCAG
TATTTCAAGAGGGGTCTTAATGTTTCCCTTTCGACTGATGACCCGCTTCAATTTGCCTTTACCAAGGAGCCGCTT
ATCGAAGAATATGCGGTAGCTGCACAGATTTACAAGCTCAGCTCCGTTGATATGTGTGAGTTGGCCAAAAATTCG
GTCAAGCAAAGCGGCTACGAAGCCTCGATCAAACGGCAGTGGCTTGGACCCGACTTCGACAAGCCTGGCATGGCG
GGTAACACCATGGCCAAGACCAACATTCCAGACAGGCGGGAAGAATTCCGTTATCATACTCTCCTCCAAGAGAGG
GATGTATTACGGCGCTACGTTATATATAATATAGACACGGAGTCAGAGGTGTTTGAAGGATCCATGTCAACTAAT
GAAGCCAATCCACCAGCCGGGGTAGTCTTATCTTCAGTTACGCCTGCACAAGGCAATCGTGGTAGCAGCGTCAGT
GCAGCTGAGGAGTACAAGTTCAATCGTGAACTGGAGCAGCCAACAGAGGCTCTAGCTAATCTTCATCTATCGGGA
AGTGATCCTAAAATATTTCCTGGCATCTTTACACGGGACCATCGAAGCAGTAGTTTACGCAACTTAGCACAGGCG
GAACAAGGGCCCATTGATTCAAATGAGGCACCCGAGGAAGATGATGATAGATAG
Gene >OphauG2|593
ATGGCCGGTAAGTAACAGGCAGCGCCTGGGGGCTTGTGTGACTGCAATGGGCTCCTCGGTTTGTGAGCTGACAGC
GCCTTTGATCTCATACGCATACTATCCAGACAGTTCTGGATTGGCTTGTAGCCCGTGAACTGGGATTTTGGCAGC
TACGATGGGGTGTAGGCTGTGGAGCCACCATTTGCTTGTGCATCGCGACTAACGCAAATCTCTTTGACAGACGAA
GCCACGCGCCAACCGGGCTGCGAGGTTGATGTTTCGACGAAGGCCCTTGAGTCGGACGACGATGAAGGAAGTGGC
GGTGGCCCCGTGCATGTGATGAACCCCAACGGCCACGAGGATGAGGGGACCCGGCAGCATAGCGGTGGATCGTCT
GCCGTGGAACCGGACGACGACATTTACCAAGACGGCATGCTGCCACGCGATGTTCCCAAACGCACAACCTTTTAC
GACCCCGTGGCTGAGCGCCAGATGACGCAGACGGACGCAAAACTTATTTATCAACGAAGCAAGATCGACAGTCGG
CCTAATATCCCGGCTTCTCGCATGCAATCTAGCTCTACTAATCAGAATCAATCCCAAAACCAAACAAGTTTCCAC
GACAGCAACTCCGCCATGCCTTGGGAATCCAAGCCCGCTACTGAATATGGGCCCGACTCTCTCGTTCTAGATAGT
AATGCTGGTACGTTAATTCCCCACTCACCATCTCTCAAGCCGCTCTCGTACAGGCATCTGCTCTAGATACAAAAC
TCAGAAGCTCGTCACAAGCAGACAGGTCTGGAGCTGTTGAGCCATTTGATCGTCGGCTCCCAATCTTGAATGGAC
AAGTTACAATCAAGGGCGCATATGCAGGCACATATACCGCCCAAGACGCCAAAACTGCTGCACAATCGACTACCA
TTCTGTCAAATAGCAGCTTATTTGACACAGAGCCACACATCACTGCCGAGCTCAGTTCTATTTCCAAGAACATCC
AGAAGATACTAGACGTCAGACGCAAGTACATCACCCTATCGTCTCAGGGGCCCCATGATAACCCTCGCGATGATG
CCGAATGGGATATTTACCCACCGCCCCCAGAGCCTGCATGGGTGCATACTGAGGCTGGCCTCAGAAAGCTTGATC
ATCAGCTGCACGACTGTCACAAGTCAGCAGACAGTGTTCATAATGCAGGGAAGAGGTCGAGACCCGACCGCAGGC
GCAAGGAGGGTCTCGATGTGGGTGAGGACTTTGATATGGAAGATCTGCAGCCACTGCCTGGCGAGGCGGGCATGA
CGTTCGAGCTCGACGAGAGTGGTGTGTACCAGGTGTTTAACGACTCTAAACAACAGCTTCCTTCTGTCAAAGTTC
CCACTATTCGCGAATTTTACATGGACTTGGATGACATCTTGACAGTATCATCCGACGGCCCTAGCAAGAGCTTCG
CCTTTCGCAGGCTGCAATACCTTGAAGGCAAATTTAACCTTTACGTCCTGCTCAATGAGTACCAGGAGACGGCCG
ACAGCAAAAAAGTTCCTCATCGCGACTTCTATAACGTGCGCAAGGTCGATACACACGTTCATCACTCGGCATGTA
TGAATCAAAAGCATCTTCTGCGCTTCATCAAGAGCAAGATGAAGAAGCATCCTAATGAAGTCGTCTTGTATCGAG
ATGGAAAGCACTTGACTCTGGCAGAAGTCTTTGCCAGCATTAATTTGACTGCCTACGATCTGAGCATTGACACGC
TGGACATGCATGTAGGTGGCAAGTTTGGGCAGGCCAGTAGTCTCAAGATAAGCCAATTGACATACTTCGTTTCAA
TAGGCACATACCGACTCTTTCCATCGTTTCGACAAGTTCAACCTTAAGTACAACCCCATTGGTGAATCCCGTCTG
AGGACAATATTCCTGAAGACGGAAAATTTCATCCACGGACGCTACCTGGCCGAGATTACCAAGGAAGTCATTTCA
GACCTTGAGTCGAGCAAGTACCAGATGGTTGAATGGCGCATCTCGATATATGGCAAATCCATCGATGAATGGGAC
AACCTTGCGGCCTGGGTCGTGGACAACAAGCTCTTTTCACACAATGTGCGCTGGCTCGTTCAGATTCCTCGCCTG
TACGATGTGTACAAGGCAAGCGGATTGATGGAGACGTTTGAGCAGGTGGTCAAGAACGTTTTCCAGCCCCTGTTT
GAAGTAACGAAGGATCCTTCAAGCCACCCAAAACTGCATATTTTCTTGCAGCGTGTGATTGGCTTTGATAGTGTC
GACGACGAAAGCAAGGTGGAGAGGCGACTTTTTAAGAAGTTTCCGGTACCACGGGCATGGGACACCAAGCAAAAT
CCGCCTTACAGCTATTGGATCTACTATCTTTTCTCTAACTTGACCTCACTCAACTATTGGCGCAAAAAGCGTGGG
TTTAACACCTTTGTGCTACGACCTCACTGCGGCGAAGCTGGTGACAGTGAGCACTTGGCTGTTGCTGTGCTTAGC
TGCCACAGCATCAGCCATGGACTCCTGCTGCGCAAGGTCCCGCTTCTTCAATACGTCTTTTATCTAGAACAGATT
GGCATCGCCATGTCACCTTTGAGCAATAATGCTCTGTTTCTAGCATACGAACGTAACCCTTTTCATCAGTATTTC
AAGAGGGGTCTTAATGTTTCCCTTTCGACTGATGACCCGCTTCAATTTGCCTTTACCAAGGAGCCGCTTATCGAA
GAATATGCGGTAGCTGCACAGATTTACAAGCTCAGCTCCGTTGATATGTGTGAGTTGGCCAAAAATTCGGTCAAG
CAAAGCGGCTACGAAGCCTCGATCAAACGGCAGTGGCTTGGACCCGACTTCGACAAGCCTGGCATGGCGGGTAAC
ACCATGGCCAAGACCAACATTCCAGACAGGCGGGAAGAATTCCGTTATCATACTCTCCTCCAAGAGAGGGATGTG
TTAGTGGTTACATGGCGAAATAACAGGTGGTGAAAGCTATGCTGACTCGCTGATTTCAGATTACGGCGCTACGTT
ATATATAATATAGACACGGAGTCAGAGGTGTTTGAAGGATCCATGTCAACTAATGAAGCCAATCCACCAGCCGGG
GTAGTCTTATCTTCAGTTACGCCTGCACAAGGCAATCGTGGTAGCAGCGTCAGTGCAGCTGAGGAGTACAAGTTC
AATCGTGAACTGGAGCAGCCAACAGAGGCTCTAGCTAATCTTCATCTATCGGGAAGTGATCCTAAAATATTTCCT
GGCATCTTTACACGGGACCATCGAAGCAGTAGTTTACGCAACTTAGCACAGGCGGAACAAGGGCCCATTGATTCA
AATGAGGCACCCGAGGAAGATGATGATAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail