Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5918
Gene name
LocationContig_575:1308..2885
Strand-
Gene length (bp)1577
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 1.1E-15 333 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SI58|CSN2_NEUCR COP9 signalosome complex subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-2 PE=1 SV=1 1 466 0.0E+00
sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 1 467 0.0E+00
sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 4 458 3.0E-144
sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 1 458 2.0E-143
sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=1 SV=1 1 458 5.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SI58|CSN2_NEUCR COP9 signalosome complex subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-2 PE=1 SV=1 1 466 0.0E+00
sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 1 467 0.0E+00
sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 4 458 3.0E-144
sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 1 458 2.0E-143
sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=1 SV=1 1 458 5.0E-143
sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 1 458 5.0E-143
sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 1 458 5.0E-143
sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 10 431 1.0E-140
sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 16 461 1.0E-134
sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 26 449 9.0E-129
sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 18 430 1.0E-114
sp|Q9HFR0|CSN2_SCHPO COP9 signalosome complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn2 PE=1 SV=1 6 432 1.0E-107
sp|A8X379|PS11B_CAEBR Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis briggsae GN=rpn-6.2 PE=3 SV=1 163 436 6.0E-18
sp|P34481|PS11B_CAEEL Probable 26S proteasome regulatory subunit rpn-6.2 OS=Caenorhabditis elegans GN=rpn-6.2 PE=3 SV=3 142 454 1.0E-16
sp|Q54UB5|PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum GN=psmD11 PE=2 SV=1 83 440 5.0E-15
sp|Q7KLV9|PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster GN=Rpn6 PE=1 SV=1 253 435 2.0E-14
sp|F6XBL2|PSD11_XENTR 26S proteasome non-ATPase regulatory subunit 11 OS=Xenopus tropicalis GN=psmd11 PE=3 SV=2 253 455 2.0E-13
sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 253 456 8.0E-13
sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=1 SV=2 253 455 1.0E-12
sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 253 455 1.0E-12
sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 253 455 1.0E-12
sp|F6P3G4|PS11A_DANRE 26S proteasome non-ATPase regulatory subunit 11A OS=Danio rerio GN=psmd11a PE=2 SV=1 253 455 1.0E-12
sp|Q9LP45|PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana GN=RPN6 PE=1 SV=1 250 448 4.0E-12
sp|F1QGH9|PS11B_DANRE 26S proteasome non-ATPase regulatory subunit 11B OS=Danio rerio GN=psmd11b PE=2 SV=1 253 455 5.0E-10
sp|Q12377|RPN6_YEAST 26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN6 PE=1 SV=3 167 463 2.0E-09
sp|Q9P7S2|RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn6 PE=3 SV=1 218 441 2.0E-08
sp|Q20938|PS11A_CAEEL Probable 26S proteasome regulatory subunit rpn-6.1 OS=Caenorhabditis elegans GN=rpn-6.1 PE=2 SV=2 252 432 3.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2322
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5918 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1447
Ophiocordyceps camponoti-floridani Ophcf2|02429
Ophiocordyceps camponoti-rufipedis Ophun1|388
Ophiocordyceps kimflemingae Ophio5|7214
Ophiocordyceps subramaniannii Hirsu2|3154

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5918
MSDDEDFMQESDEEQYDFEYEEDDDADSGDVDIENKYYNAKQLKLTDPDDAIDEFLGIPELEQNKGEWGFKGLKQ
AIKLEFKQGKYDKVRGLWVRMLGERLIQDQAADHYAELLTYVKSAVTRNYSEKSINNILDFIEKGADHGNAIKSM
EKFYSLTLDSFQSTNNERLWLKTNLKLARLLLDRGDFAAVGRKLREVHRTCQRPDGSDDPTKGTYSLEAYALEIQ
MLAATRSNQQLKALYERALKVKSAVPHPRVMGVIRECGGKMHMSEENWEAAQRDFFESFRNYDEAGSLQRITVLK
YLLLTTMLVRSTINPLDSQETKPYRSDPRVAGMTQLVDAYQRDDVHAYEKVLEDNPEILEDRFIAENIDEVTRTM
RTKGVLKLIVPYSLMRLSWISKQLRIPVTEVSDILGFLIIDGKIRGHIDQLNGLLVIESEADEERSNAILNLTSS
LKDLYTAVFREGNGFRNTETLDEALHSASGLLLKKGNRAHLKAKRGKWPSGVNFQA*
Coding >OphauG2|5918
ATGTCAGACGACGAGGACTTCATGCAAGAGTCGGATGAGGAGCAGTACGACTTTGAGTACGAAGAAGACGACGAC
GCAGACTCGGGCGACGTTGACATTGAGAACAAATACTACAACGCCAAGCAGCTGAAACTAACGGATCCCGATGAT
GCTATTGATGAGTTTCTGGGCATTCCAGAGCTGGAGCAAAACAAGGGCGAGTGGGGCTTCAAAGGTCTCAAACAA
GCCATCAAACTCGAGTTCAAGCAAGGCAAATACGACAAGGTGCGCGGATTGTGGGTGAGGATGCTTGGAGAGAGG
CTGATTCAAGACCAGGCCGCAGACCACTACGCCGAGCTGCTCACGTACGTCAAGTCGGCCGTTACACGCAACTAT
TCTGAAAAGTCCATCAATAACATTCTCGACTTCATTGAAAAGGGCGCAGACCATGGCAACGCCATCAAGAGCATG
GAAAAGTTCTACTCGCTCACTCTCGACAGCTTCCAAAGCACAAACAACGAACGGCTGTGGCTCAAGACAAACCTC
AAGCTGGCCCGGCTGCTGCTCGACCGCGGCGACTTTGCTGCTGTCGGCCGCAAGCTCCGCGAGGTGCATCGCACG
TGCCAGCGGCCTGATGGCTCCGACGACCCGACAAAAGGCACCTACTCGCTCGAGGCGTATGCTCTCGAGATTCAG
ATGCTGGCAGCCACGCGCAGCAACCAGCAGCTCAAGGCGCTGTATGAGCGTGCTCTCAAGGTAAAGTCGGCCGTC
CCGCATCCGCGCGTTATGGGCGTTATTCGCGAATGCGGAGGCAAGATGCACATGAGCGAGGAGAACTGGGAGGCG
GCGCAGCGAGACTTTTTCGAGTCCTTCCGTAACTATGATGAGGCCGGCTCGCTGCAACGCATCACCGTTCTCAAA
TATCTTCTCCTCACCACCATGTTGGTGCGCTCCACCATTAATCCGCTCGACTCGCAAGAGACGAAGCCCTACCGC
TCGGATCCGCGCGTTGCTGGCATGACGCAGCTTGTCGATGCCTACCAGCGAGACGACGTGCACGCCTATGAAAAG
GTGCTGGAGGACAACCCCGAAATCCTCGAGGACAGGTTCATTGCCGAGAATATCGACGAGGTGACGCGCACCATG
CGTACCAAGGGCGTGCTCAAGCTCATTGTCCCCTACTCGCTCATGCGCCTGTCTTGGATTTCCAAGCAGCTGCGC
ATCCCCGTGACCGAAGTGTCGGACATTCTTGGCTTCCTCATCATTGACGGCAAGATTCGAGGCCACATTGACCAG
CTAAACGGCTTACTGGTTATAGAGTCGGAAGCCGACGAGGAGCGCAGCAACGCCATTCTCAATCTCACTAGCTCC
CTCAAGGACCTCTATACGGCCGTCTTTCGAGAGGGCAATGGCTTCAGAAACACTGAGACTCTGGACGAGGCCTTG
CACAGCGCCTCGGGGCTCTTGCTTAAGAAGGGAAATCGAGCCCATCTCAAGGCCAAGAGAGGCAAATGGCCTTCT
GGTGTGAACTTTCAGGCCTAG
Transcript >OphauG2|5918
ATGTCAGACGACGAGGACTTCATGCAAGAGTCGGATGAGGAGCAGTACGACTTTGAGTACGAAGAAGACGACGAC
GCAGACTCGGGCGACGTTGACATTGAGAACAAATACTACAACGCCAAGCAGCTGAAACTAACGGATCCCGATGAT
GCTATTGATGAGTTTCTGGGCATTCCAGAGCTGGAGCAAAACAAGGGCGAGTGGGGCTTCAAAGGTCTCAAACAA
GCCATCAAACTCGAGTTCAAGCAAGGCAAATACGACAAGGTGCGCGGATTGTGGGTGAGGATGCTTGGAGAGAGG
CTGATTCAAGACCAGGCCGCAGACCACTACGCCGAGCTGCTCACGTACGTCAAGTCGGCCGTTACACGCAACTAT
TCTGAAAAGTCCATCAATAACATTCTCGACTTCATTGAAAAGGGCGCAGACCATGGCAACGCCATCAAGAGCATG
GAAAAGTTCTACTCGCTCACTCTCGACAGCTTCCAAAGCACAAACAACGAACGGCTGTGGCTCAAGACAAACCTC
AAGCTGGCCCGGCTGCTGCTCGACCGCGGCGACTTTGCTGCTGTCGGCCGCAAGCTCCGCGAGGTGCATCGCACG
TGCCAGCGGCCTGATGGCTCCGACGACCCGACAAAAGGCACCTACTCGCTCGAGGCGTATGCTCTCGAGATTCAG
ATGCTGGCAGCCACGCGCAGCAACCAGCAGCTCAAGGCGCTGTATGAGCGTGCTCTCAAGGTAAAGTCGGCCGTC
CCGCATCCGCGCGTTATGGGCGTTATTCGCGAATGCGGAGGCAAGATGCACATGAGCGAGGAGAACTGGGAGGCG
GCGCAGCGAGACTTTTTCGAGTCCTTCCGTAACTATGATGAGGCCGGCTCGCTGCAACGCATCACCGTTCTCAAA
TATCTTCTCCTCACCACCATGTTGGTGCGCTCCACCATTAATCCGCTCGACTCGCAAGAGACGAAGCCCTACCGC
TCGGATCCGCGCGTTGCTGGCATGACGCAGCTTGTCGATGCCTACCAGCGAGACGACGTGCACGCCTATGAAAAG
GTGCTGGAGGACAACCCCGAAATCCTCGAGGACAGGTTCATTGCCGAGAATATCGACGAGGTGACGCGCACCATG
CGTACCAAGGGCGTGCTCAAGCTCATTGTCCCCTACTCGCTCATGCGCCTGTCTTGGATTTCCAAGCAGCTGCGC
ATCCCCGTGACCGAAGTGTCGGACATTCTTGGCTTCCTCATCATTGACGGCAAGATTCGAGGCCACATTGACCAG
CTAAACGGCTTACTGGTTATAGAGTCGGAAGCCGACGAGGAGCGCAGCAACGCCATTCTCAATCTCACTAGCTCC
CTCAAGGACCTCTATACGGCCGTCTTTCGAGAGGGCAATGGCTTCAGAAACACTGAGACTCTGGACGAGGCCTTG
CACAGCGCCTCGGGGCTCTTGCTTAAGAAGGGAAATCGAGCCCATCTCAAGGCCAAGAGAGGCAAATGGCCTTCT
GGTGTGAACTTTCAGGCCTAG
Gene >OphauG2|5918
ATGTCAGACGACGAGGACTTCATGCAAGAGTCGGATGAGGAGCAGTGAGTCTGCTCAGGCGGCCGGCGCTGCAAG
CCTGCTCGACTAACCAAGGCAACAGGTACGACTTTGAGTACGAAGAAGACGACGACGCAGACTCGGGCGACGTTG
ACATTGAGAACAAATACTACAACGCCAAGCAGCTGAAACTAACGGATCCCGATGATGCTATTGATGAGTTTCTGG
GCATTCCAGAGCTGGAGCAAAACAAGGGCGAGTGGGGCTTCAAAGGTCTCAAACAAGCCATCAAACTCGAGTTCA
AGCAAGGCAAATACGACAAGGTGCGCGGATTGTGGGTGAGGATGCTTGGAGAGAGGCTGATTCAAGACCAGGCCG
CAGACCACTACGCCGAGCTGCTCACGTACGTCAAGTCGGCCGTTACACGCAACTATTCTGAAAAGTCCATCAATA
ACATTCTCGACTTCATTGAAAAGGGCGCAGACCATGGCAACGCCATCAAGAGCATGGAAAAGTTCTACTCGCTCA
CTCTCGACAGCTTCCAAAGCACAAACAACGAACGGCTGTGGCTCAAGACAAACCTCAAGCTGGCCCGGCTGCTGC
TCGACCGCGGCGACTTTGCTGCTGTCGGCCGCAAGCTCCGCGAGGTGCATCGCACGTGCCAGCGGCCTGATGGCT
CCGACGACCCGACAAAAGGCACCTACTCGCTCGAGGCGTATGCTCTCGAGATTCAGATGCTGGCAGCCACGCGCA
GCAACCAGCAGCTCAAGGCGCTGTATGAGCGTGCTCTCAAGGTAAAGTCGGCCGTCCCGCATCCGCGCGTTATGG
GCGTTATTCGCGAATGCGGAGGCAAGATGCACATGAGCGAGGAGAACTGGGAGGCGGCGCAGCGAGACTTTTTCG
AGTCCTTCCGTAACTATGATGAGGCCGGCTCGCTGCAACGCATCACCGTTCTCAAATATCTTCTCCTCACCACCA
TGTTGGTGCGCTCCACCATTAATCCGCTCGACTCGCAAGAGACGAAGCCCTACCGCTCGGATCCGCGCGTTGCTG
GCATGACGCAGCTTGTCGATGCCTACCAGCGAGACGACGTGCACGCCTATGAAAAGGTGCTGGAGGACAACCCCG
AAATCCTCGAGGACAGGTTCATTGCCGAGAATATCGACGAGGTGACGCGCACCATGCGTACCAAGGGCGTGCTCA
AGCTCATTGTCCCCTACTCGCTCATGCGCCTGTCTTGGATTTCCAAGCAGCTGCGCATCCCCGTGACCGAAGTGT
CGGACATTCTTGGCTTCCTCATCATTGACGGCAAGATTCGAGGCCACATTGACCAGCTAAACGGCTTACTGGTTA
TAGAGTCGGAAGCCGACGAGGAGCGCAGCAACGCCATTCTCAATCTCACTAGCTCCCTCAAGGACCTCTATACGG
CCGTCTTTCGAGAGGGCAATGGCTTCAGAAACACTGAGACTCTGGACGAGGCCTTGCACAGCGCCTCGGGGCTCT
TGCTTAAGAAGGGAAATCGAGCCCATCTCAAGGCCAAGAGAGGCAAATGGCCTTCTGGTGTGAACTTTCAGGCCT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail