Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5916
Gene name
LocationContig_574:7318..7774
Strand-
Gene length (bp)456
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02502 LacAB_rpiB Ribose/Galactose Isomerase 3.8E-40 7 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CL19|RPIB_COCIM Putative ribose 5-phosphate isomerase OS=Coccidioides immitis (strain RS) GN=CIMG_07932 PE=1 SV=1 7 146 3.0E-60
sp|P39156|YWLF_BACSU Putative sugar phosphate isomerase YwlF OS=Bacillus subtilis (strain 168) GN=ywlF PE=2 SV=1 2 129 4.0E-25
sp|P37351|RPIB_ECOLI Ribose-5-phosphate isomerase B OS=Escherichia coli (strain K12) GN=rpiB PE=1 SV=2 16 146 1.0E-23
sp|Q97F02|LACB_CLOAB Galactose-6-phosphate isomerase subunit LacB OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lacB PE=3 SV=1 24 145 5.0E-15
sp|Q8CRJ3|LACB_STAES Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lacB PE=3 SV=1 24 150 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CL19|RPIB_COCIM Putative ribose 5-phosphate isomerase OS=Coccidioides immitis (strain RS) GN=CIMG_07932 PE=1 SV=1 7 146 3.0E-60
sp|P39156|YWLF_BACSU Putative sugar phosphate isomerase YwlF OS=Bacillus subtilis (strain 168) GN=ywlF PE=2 SV=1 2 129 4.0E-25
sp|P37351|RPIB_ECOLI Ribose-5-phosphate isomerase B OS=Escherichia coli (strain K12) GN=rpiB PE=1 SV=2 16 146 1.0E-23
sp|Q97F02|LACB_CLOAB Galactose-6-phosphate isomerase subunit LacB OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lacB PE=3 SV=1 24 145 5.0E-15
sp|Q8CRJ3|LACB_STAES Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lacB PE=3 SV=1 24 150 2.0E-14
sp|Q5HM36|LACB_STAEQ Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lacB PE=3 SV=1 24 150 2.0E-14
sp|P65647|LACB_STAAN Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain N315) GN=lacB PE=1 SV=1 24 150 3.0E-14
sp|P65646|LACB_STAAM Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lacB PE=3 SV=1 24 150 3.0E-14
sp|A5IUY3|LACB_STAA9 Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain JH9) GN=lacB PE=3 SV=1 24 150 3.0E-14
sp|A6U3S4|LACB_STAA2 Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain JH1) GN=lacB PE=3 SV=1 24 150 3.0E-14
sp|A7X578|LACB_STAA1 Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lacB PE=3 SV=1 24 150 3.0E-14
sp|Q4L873|LACB_STAHJ Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lacB PE=3 SV=1 27 147 4.0E-14
sp|Q5HE11|LACB_STAAC Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain COL) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|Q2FET8|LACB_STAA3 Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain USA300) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|Q2G2R0|LACB_STAA8 Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain NCTC 8325) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|A6QJ38|LACB_STAAE Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain Newman) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|Q6G7C0|LACB_STAAS Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain MSSA476) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|A8YYG1|LACB_STAAT Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|P0C1R6|LACB_STAAU Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|P68797|LACB_STAAW Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain MW2) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|Q6GEN5|LACB_STAAR Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain MRSA252) GN=lacB PE=3 SV=1 24 150 8.0E-14
sp|Q2YYJ4|LACB_STAAB Galactose-6-phosphate isomerase subunit LacB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lacB PE=3 SV=1 24 147 1.0E-13
sp|P26424|LACB_STRMU Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lacB PE=3 SV=2 28 147 6.0E-13
sp|B5E4T1|LACB_STRP4 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|Q04KC2|LACB_STRP2 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|C1C7G1|LACB_STRP7 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain 70585) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|B1IBZ6|LACB_STRPI Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|B8ZQ65|LACB_STRPJ Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|B2IPT6|LACB_STRPS Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain CGSP14) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|Q8DPP0|LACB_STRR6 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|C1CKT8|LACB_STRZP Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain P1031) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|Q97QL1|LACB_STRPN Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|C1CEF3|LACB_STRZJ Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain JJA) GN=lacB PE=3 SV=1 24 147 4.0E-12
sp|A3CPH6|LACB_STRSV Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus sanguinis (strain SK36) GN=lacB PE=3 SV=1 24 150 7.0E-12
sp|P53527|RPIB_MYCPN Probable ribose-5-phosphate isomerase B OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpiB PE=1 SV=1 7 130 9.0E-12
sp|C1CRA5|LACB_STRZT Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lacB PE=3 SV=1 24 147 2.0E-11
sp|P23495|LACB_LACLL Galactose-6-phosphate isomerase subunit LacB OS=Lactococcus lactis subsp. lactis GN=lacB PE=1 SV=1 24 150 3.0E-11
sp|C0MDX5|LACB_STRS7 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lacB PE=3 SV=1 24 147 3.0E-11
sp|Q8DXC1|LACB_STRA5 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lacB PE=3 SV=1 28 147 4.0E-11
sp|Q3JZ19|LACB_STRA1 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lacB PE=3 SV=1 28 147 4.0E-11
sp|Q8E345|LACB2_STRA3 Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lacB2 PE=3 SV=1 28 147 4.0E-11
sp|Q48RW0|LACB1_STRPM Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lacB1 PE=3 SV=2 24 147 7.0E-11
sp|Q5XAI2|LACB1_STRP6 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lacB1 PE=3 SV=2 24 147 7.0E-11
sp|Q99YH2|LACB1_STRP1 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M1 GN=lacB1 PE=3 SV=1 24 147 7.0E-11
sp|C0M8Q7|LACB_STRE4 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus equi subsp. equi (strain 4047) GN=lacB PE=3 SV=1 24 147 7.0E-11
sp|Q833U4|LACB_ENTFA Galactose-6-phosphate isomerase subunit LacB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lacB PE=3 SV=1 28 146 7.0E-11
sp|P0DC09|LACB1_STRPQ Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lacB1 PE=3 SV=1 24 147 8.0E-11
sp|P0DC08|LACB1_STRP3 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lacB1 PE=3 SV=1 24 147 8.0E-11
sp|A2RD12|LACB_STRPG Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=lacB PE=3 SV=1 24 147 8.0E-11
sp|B4U1F9|LACB_STREM Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lacB PE=3 SV=1 24 147 2.0E-10
sp|Q8XNK6|LACB_CLOPE Galactose-6-phosphate isomerase subunit LacB OS=Clostridium perfringens (strain 13 / Type A) GN=lacB PE=3 SV=1 28 146 3.0E-10
sp|A4VV69|LACB_STRSY Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus suis (strain 05ZYH33) GN=lacB PE=3 SV=1 28 147 5.0E-10
sp|A4W1H6|LACB_STRS2 Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus suis (strain 98HAH33) GN=lacB PE=3 SV=1 28 147 5.0E-10
sp|Q8NZD8|LACB2_STRP8 Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lacB2 PE=3 SV=1 27 149 6.0E-10
sp|Q5X9Y2|LACB2_STRP6 Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lacB2 PE=3 SV=1 24 146 1.0E-09
sp|Q8NZV7|LACB1_STRP8 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lacB1 PE=3 SV=1 24 147 1.0E-09
sp|Q8E4R6|LACB1_STRA3 Galactose-6-phosphate isomerase subunit LacB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lacB1 PE=3 SV=1 24 147 1.0E-09
sp|Q48RC3|LACB2_STRPM Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lacB2 PE=3 SV=1 24 149 1.0E-09
sp|Q1JJZ6|LACB_STRPC Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lacB PE=3 SV=1 24 149 3.0E-09
sp|Q1J9U7|LACB_STRPB Galactose-6-phosphate isomerase subunit LacB OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lacB PE=3 SV=1 24 149 3.0E-09
sp|Q99Y13|LACB2_STRP1 Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M1 GN=lacB2 PE=3 SV=1 24 149 3.0E-09
sp|P0DC11|LACB2_STRPQ Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lacB2 PE=3 SV=1 27 149 5.0E-09
sp|P0DC10|LACB2_STRP3 Galactose-6-phosphate isomerase subunit LacB 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lacB2 PE=3 SV=1 27 149 5.0E-09
sp|P47636|RPIB_MYCGE Probable ribose-5-phosphate isomerase B OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpiB PE=3 SV=1 7 130 4.0E-08
sp|Q4UM83|Y486_RICFE Putative sugar phosphate isomerase RF_0486 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0486 PE=3 SV=1 7 130 8.0E-08
sp|Q9ZDM8|Y299_RICPR Putative sugar phosphate isomerase RP299 OS=Rickettsia prowazekii (strain Madrid E) GN=RP299 PE=3 SV=1 7 130 1.0E-06
sp|Q68X72|Y290_RICTY Putative sugar phosphate isomerase RT0290 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0290 PE=3 SV=1 7 130 1.0E-06
sp|Q92IL8|Y402_RICCN Putative sugar phosphate isomerase RC0402 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0402 PE=3 SV=1 7 130 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016853 isomerase activity Yes
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6029
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5916 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7260
Ophiocordyceps kimflemingae Ophio5|7067
Ophiocordyceps subramaniannii Hirsu2|1196

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5916
MSDNGQEAGVSYKAALKRDLEADSRVSQVIDVGSCEASDKTAYPLRAAEAARLVAQGKADRALLVCGTGLGVAIA
ANKIKGVRAVTAHDSFSVERSVLSNNAQVLCMGERVVGLELARRLAREWLGYEFDATSASAQKVREIEELEAATS
F*
Coding >OphauG2|5916
ATGAGCGACAATGGACAGGAGGCCGGCGTCTCGTACAAAGCGGCCCTCAAGCGTGACTTGGAGGCGGACAGCCGA
GTGTCCCAAGTCATCGACGTCGGGTCCTGTGAGGCCAGCGACAAGACGGCCTATCCCCTCCGAGCAGCAGAGGCA
GCGCGGCTTGTGGCGCAGGGCAAGGCAGACCGGGCGCTGCTGGTGTGCGGCACGGGGCTGGGAGTCGCCATTGCG
GCAAACAAGATCAAGGGCGTGCGCGCCGTGACGGCTCACGACAGCTTCAGCGTCGAGCGCAGCGTGCTGAGCAAC
AATGCCCAGGTGCTGTGCATGGGCGAGCGAGTGGTTGGGCTGGAGCTGGCCAGGAGGCTTGCGCGCGAGTGGTTG
GGCTACGAGTTTGATGCTACGAGTGCGAGTGCGCAAAAGGTGCGAGAAATTGAGGAGCTCGAGGCGGCCACGAGT
TTTTGA
Transcript >OphauG2|5916
ATGAGCGACAATGGACAGGAGGCCGGCGTCTCGTACAAAGCGGCCCTCAAGCGTGACTTGGAGGCGGACAGCCGA
GTGTCCCAAGTCATCGACGTCGGGTCCTGTGAGGCCAGCGACAAGACGGCCTATCCCCTCCGAGCAGCAGAGGCA
GCGCGGCTTGTGGCGCAGGGCAAGGCAGACCGGGCGCTGCTGGTGTGCGGCACGGGGCTGGGAGTCGCCATTGCG
GCAAACAAGATCAAGGGCGTGCGCGCCGTGACGGCTCACGACAGCTTCAGCGTCGAGCGCAGCGTGCTGAGCAAC
AATGCCCAGGTGCTGTGCATGGGCGAGCGAGTGGTTGGGCTGGAGCTGGCCAGGAGGCTTGCGCGCGAGTGGTTG
GGCTACGAGTTTGATGCTACGAGTGCGAGTGCGCAAAAGGTGCGAGAAATTGAGGAGCTCGAGGCGGCCACGAGT
TTTTGA
Gene >OphauG2|5916
ATGAGCGACAATGGACAGGAGGCCGGCGTCTCGTACAAAGCGGCCCTCAAGCGTGACTTGGAGGCGGACAGCCGA
GTGTCCCAAGTCATCGACGTCGGGTCCTGTGAGGCCAGCGACAAGACGGCCTATCCCCTCCGAGCAGCAGAGGCA
GCGCGGCTTGTGGCGCAGGGCAAGGCAGACCGGGCGCTGCTGGTGTGCGGCACGGGGCTGGGAGTCGCCATTGCG
GCAAACAAGATCAAGGGCGTGCGCGCCGTGACGGCTCACGACAGCTTCAGCGTCGAGCGCAGCGTGCTGAGCAAC
AATGCCCAGGTGCTGTGCATGGGCGAGCGAGTGGTTGGGCTGGAGCTGGCCAGGAGGCTTGCGCGCGAGTGGTTG
GGCTACGAGTTTGATGCTACGAGTGCGAGTGCGCAAAAGGTGCGAGAAATTGAGGAGCTCGAGGCGGCCACGAGT
TTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail