Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|591
Gene name
LocationContig_1140:3714..4678
Strand-
Gene length (bp)964
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00596 Aldolase_II Class II Aldolase and Adducin N-terminal domain 3.1E-44 21 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YHA8|MTNB_NECH7 Methylthioribulose-1-phosphate dehydratase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MDE1 PE=3 SV=1 3 242 1.0E-137
sp|A4RK52|MTNB_MAGO7 Methylthioribulose-1-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDE1 PE=3 SV=2 6 242 1.0E-129
sp|A7EH92|MTNB_SCLS1 Methylthioribulose-1-phosphate dehydratase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mde1 PE=3 SV=1 6 238 4.0E-129
sp|B2A8X1|MTNB_PODAN Methylthioribulose-1-phosphate dehydratase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDE1 PE=3 SV=1 6 242 7.0E-129
sp|Q2HE69|MTNB_CHAGB Methylthioribulose-1-phosphate dehydratase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDE1 PE=3 SV=1 6 242 9.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YHA8|MTNB_NECH7 Methylthioribulose-1-phosphate dehydratase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MDE1 PE=3 SV=1 3 242 1.0E-137
sp|A4RK52|MTNB_MAGO7 Methylthioribulose-1-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDE1 PE=3 SV=2 6 242 1.0E-129
sp|A7EH92|MTNB_SCLS1 Methylthioribulose-1-phosphate dehydratase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mde1 PE=3 SV=1 6 238 4.0E-129
sp|B2A8X1|MTNB_PODAN Methylthioribulose-1-phosphate dehydratase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDE1 PE=3 SV=1 6 242 7.0E-129
sp|Q2HE69|MTNB_CHAGB Methylthioribulose-1-phosphate dehydratase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDE1 PE=3 SV=1 6 242 9.0E-128
sp|A6RI12|MTNB_BOTFB Methylthioribulose-1-phosphate dehydratase OS=Botryotinia fuckeliana (strain B05.10) GN=mde1 PE=3 SV=1 6 238 1.0E-126
sp|D1ZJC1|MTNB_SORMK Methylthioribulose-1-phosphate dehydratase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MDE1 PE=3 SV=1 6 241 7.0E-125
sp|Q7SF46|MTNB_NEUCR Methylthioribulose-1-phosphate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mde1 PE=3 SV=1 6 242 4.0E-121
sp|C0S4Z7|MTNB_PARBP Methylthioribulose-1-phosphate dehydratase OS=Paracoccidioides brasiliensis (strain Pb03) GN=MDE1 PE=3 SV=1 6 232 3.0E-103
sp|C1G3Q0|MTNB_PARBD Methylthioribulose-1-phosphate dehydratase OS=Paracoccidioides brasiliensis (strain Pb18) GN=MDE1 PE=3 SV=1 6 232 3.0E-103
sp|C0NN25|MTNB_AJECG Methylthioribulose-1-phosphate dehydratase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MDE1 PE=3 SV=1 6 232 4.0E-103
sp|C1H861|MTNB_PARBA Methylthioribulose-1-phosphate dehydratase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MDE1 PE=3 SV=1 6 232 6.0E-103
sp|A6RAS3|MTNB_AJECN Methylthioribulose-1-phosphate dehydratase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MDE1 PE=3 SV=1 6 232 6.0E-103
sp|C6H2R1|MTNB_AJECH Methylthioribulose-1-phosphate dehydratase OS=Ajellomyces capsulatus (strain H143) GN=MDE1 PE=3 SV=1 6 232 6.0E-103
sp|Q2UUH5|MTNB_ASPOR Methylthioribulose-1-phosphate dehydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mde1 PE=3 SV=1 6 233 5.0E-100
sp|B8NSW2|MTNB_ASPFN Methylthioribulose-1-phosphate dehydratase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mde1 PE=3 SV=1 6 233 5.0E-100
sp|A2Q9M4|MTNB_ASPNC Methylthioribulose-1-phosphate dehydratase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mde1 PE=3 SV=1 6 233 2.0E-98
sp|Q0CT19|MTNB_ASPTN Methylthioribulose-1-phosphate dehydratase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mde1 PE=3 SV=1 6 232 3.0E-97
sp|C5GGA4|MTNB_AJEDR Methylthioribulose-1-phosphate dehydratase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MDE1 PE=3 SV=1 6 232 1.0E-96
sp|C5JIC2|MTNB_AJEDS Methylthioribulose-1-phosphate dehydratase OS=Ajellomyces dermatitidis (strain SLH14081) GN=MDE1 PE=3 SV=1 6 232 1.0E-96
sp|Q4WQH4|MTNB_ASPFU Methylthioribulose-1-phosphate dehydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mde1 PE=3 SV=1 6 232 2.0E-96
sp|B0Y4N9|MTNB_ASPFC Methylthioribulose-1-phosphate dehydratase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mde1 PE=3 SV=1 6 232 2.0E-96
sp|C5FEJ4|MTNB_ARTOC Methylthioribulose-1-phosphate dehydratase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MDE1 PE=3 SV=2 6 231 3.0E-96
sp|Q5B787|MTNB_EMENI Methylthioribulose-1-phosphate dehydratase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mde1 PE=3 SV=1 6 232 2.0E-95
sp|A1CW59|MTNB_NEOFI Methylthioribulose-1-phosphate dehydratase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mde1 PE=3 SV=1 6 232 2.0E-95
sp|B2WCB2|MTNB_PYRTR Methylthioribulose-1-phosphate dehydratase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mde1 PE=3 SV=1 6 229 5.0E-95
sp|Q0UUN6|MTNB_PHANO Methylthioribulose-1-phosphate dehydratase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDE1 PE=3 SV=1 6 229 1.0E-94
sp|C4JKS2|MTNB_UNCRE Methylthioribulose-1-phosphate dehydratase OS=Uncinocarpus reesii (strain UAMH 1704) GN=MDE1 PE=3 SV=1 4 232 1.0E-94
sp|C5PIC1|MTNB_COCP7 Methylthioribulose-1-phosphate dehydratase OS=Coccidioides posadasii (strain C735) GN=MDE1 PE=3 SV=1 6 232 1.0E-94
sp|A1CIK4|MTNB_ASPCL Methylthioribulose-1-phosphate dehydratase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mde1 PE=3 SV=1 6 232 2.0E-93
sp|B6HNY8|MTNB_PENRW Methylthioribulose-1-phosphate dehydratase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mde1 PE=3 SV=1 6 232 2.0E-92
sp|B6QQ13|MTNB_TALMQ Methylthioribulose-1-phosphate dehydratase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mde1 PE=3 SV=1 6 229 1.0E-83
sp|C4R7D9|MTNB_PICPG Methylthioribulose-1-phosphate dehydratase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MDE1 PE=3 SV=1 4 231 4.0E-83
sp|B8LXM1|MTNB_TALSN Methylthioribulose-1-phosphate dehydratase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mde1 PE=3 SV=1 6 229 2.0E-82
sp|Q6CBB0|MTNB_YARLI Methylthioribulose-1-phosphate dehydratase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDE1 PE=3 SV=1 8 228 6.0E-81
sp|B0CZ32|MTNB_LACBS Methylthioribulose-1-phosphate dehydratase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MDE1 PE=3 SV=1 6 231 2.0E-76
sp|A3LVM9|MTNB_PICST Methylthioribulose-1-phosphate dehydratase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MDE1 PE=3 SV=2 4 232 2.0E-75
sp|A8NQV9|MTNB_COPC7 Methylthioribulose-1-phosphate dehydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MDE1 PE=3 SV=2 4 231 4.0E-75
sp|C5DCA2|MTNB_LACTC Methylthioribulose-1-phosphate dehydratase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MDE1 PE=3 SV=1 4 229 5.0E-75
sp|P0CM14|MTNB_CRYNJ Methylthioribulose-1-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDE1 PE=3 SV=1 6 233 1.0E-74
sp|P0CM15|MTNB_CRYNB Methylthioribulose-1-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDE1 PE=3 SV=1 6 233 1.0E-74
sp|A5E3E3|MTNB_LODEL Methylthioribulose-1-phosphate dehydratase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MDE1 PE=3 SV=1 4 233 6.0E-74
sp|C5MHJ2|MTNB_CANTT Methylthioribulose-1-phosphate dehydratase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MDE1 PE=3 SV=1 4 233 2.0E-72
sp|B9WHK1|MTNB_CANDC Methylthioribulose-1-phosphate dehydratase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MDE1 PE=3 SV=1 4 233 7.0E-72
sp|C4YRG6|MTNB_CANAW Methylthioribulose-1-phosphate dehydratase OS=Candida albicans (strain WO-1) GN=MDE1 PE=3 SV=1 4 232 1.0E-71
sp|Q5AG73|MTNB_CANAL Methylthioribulose-1-phosphate dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDE1 PE=3 SV=1 4 232 2.0E-71
sp|C4XXU2|MTNB_CLAL4 Methylthioribulose-1-phosphate dehydratase OS=Clavispora lusitaniae (strain ATCC 42720) GN=MDE1 PE=3 SV=1 11 231 3.0E-70
sp|P47095|MTNB_YEAST Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDE1 PE=1 SV=1 2 229 8.0E-70
sp|Q6BIX5|MTNB_DEBHA Methylthioribulose-1-phosphate dehydratase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MDE1 PE=3 SV=1 6 229 1.0E-69
sp|C7GKY0|MTNB_YEAS2 Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain JAY291) GN=MDE1 PE=3 SV=1 2 229 2.0E-69
sp|B5X277|MTNB_SALSA Methylthioribulose-1-phosphate dehydratase OS=Salmo salar GN=apip PE=2 SV=1 11 225 2.0E-69
sp|B5VLI6|MTNB_YEAS6 Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MDE1 PE=3 SV=1 2 229 2.0E-69
sp|B3LQB9|MTNB_YEAS1 Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MDE1 PE=3 SV=1 2 229 2.0E-69
sp|A6ZPY9|MTNB_YEAS7 Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain YJM789) GN=MDE1 PE=3 SV=1 2 229 2.0E-69
sp|C1BJB1|MTNB_OSMMO Methylthioribulose-1-phosphate dehydratase OS=Osmerus mordax GN=apip PE=2 SV=1 12 228 2.0E-69
sp|Q75CP5|MTNB_ASHGO Methylthioribulose-1-phosphate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDE1 PE=3 SV=1 8 229 5.0E-69
sp|Q5ZLP2|MTNB_CHICK Methylthioribulose-1-phosphate dehydratase OS=Gallus gallus GN=APIP PE=2 SV=1 11 225 5.0E-69
sp|Q5FW37|MTNB_XENTR Methylthioribulose-1-phosphate dehydratase OS=Xenopus tropicalis GN=apip PE=2 SV=1 10 225 8.0E-69
sp|A5DHV9|MTNB_PICGU Methylthioribulose-1-phosphate dehydratase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MDE1 PE=3 SV=2 2 223 2.0E-68
sp|A7TET7|MTNB_VANPO Methylthioribulose-1-phosphate dehydratase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDE1 PE=3 SV=1 1 229 2.0E-68
sp|A4HGN7|MTNB_LEIBR Probable methylthioribulose-1-phosphate dehydratase OS=Leishmania braziliensis GN=LbrM28_V2.2010 PE=3 SV=1 7 228 3.0E-68
sp|C1C4M8|MTNB_LITCT Methylthioribulose-1-phosphate dehydratase OS=Lithobates catesbeiana GN=apip PE=2 SV=1 10 228 3.0E-68
sp|Q6NU29|MTNB_XENLA Methylthioribulose-1-phosphate dehydratase OS=Xenopus laevis GN=apip PE=2 SV=1 10 225 4.0E-68
sp|Q4Q882|MTNB_LEIMA Probable methylthioribulose-1-phosphate dehydratase OS=Leishmania major GN=LmjF28.1840 PE=3 SV=1 8 228 5.0E-68
sp|Q9WVQ5|MTNB_MOUSE Methylthioribulose-1-phosphate dehydratase OS=Mus musculus GN=Apip PE=1 SV=1 11 228 2.0E-67
sp|Q96GX9|MTNB_HUMAN Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens GN=APIP PE=1 SV=1 11 228 3.0E-67
sp|C1BYA3|MTNB_ESOLU Methylthioribulose-1-phosphate dehydratase OS=Esox lucius GN=apip PE=2 SV=1 11 228 9.0E-67
sp|C5E0B9|MTNB_ZYGRC Methylthioribulose-1-phosphate dehydratase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MDE1 PE=3 SV=1 6 229 1.0E-66
sp|Q6FJA5|MTNB_CANGA Methylthioribulose-1-phosphate dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDE1 PE=3 SV=1 18 229 1.0E-66
sp|A9VCQ2|MTNB_MONBE Probable methylthioribulose-1-phosphate dehydratase OS=Monosiga brevicollis GN=29994 PE=3 SV=1 14 228 2.0E-66
sp|Q66I75|MTNB_DANRE Methylthioribulose-1-phosphate dehydratase OS=Danio rerio GN=apip PE=2 SV=1 11 225 4.0E-66
sp|A4I3R0|MTNB_LEIIN Probable methylthioribulose-1-phosphate dehydratase OS=Leishmania infantum GN=LinJ28.1900 PE=3 SV=1 11 228 1.0E-65
sp|Q54NY7|MTNB_DICDI Probable methylthioribulose-1-phosphate dehydratase OS=Dictyostelium discoideum GN=DDB_G0284915 PE=3 SV=1 9 228 2.0E-64
sp|Q0VCJ2|MTNB_BOVIN Methylthioribulose-1-phosphate dehydratase OS=Bos taurus GN=APIP PE=2 SV=1 11 228 3.0E-64
sp|B3MW09|MTNB_DROAN Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila ananassae GN=GF22600 PE=3 SV=1 15 228 9.0E-64
sp|Q7PS09|MTNB_ANOGA Probable methylthioribulose-1-phosphate dehydratase OS=Anopheles gambiae GN=AGAP000470 PE=3 SV=5 15 228 7.0E-63
sp|B4JLL3|MTNB_DROGR Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila grimshawi GN=GH11851 PE=3 SV=1 15 228 8.0E-63
sp|B4R4E9|MTNB_DROSI Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila simulans GN=GD17142 PE=3 SV=1 15 228 3.0E-62
sp|B4IG61|MTNB_DROSE Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila sechellia GN=GM17635 PE=3 SV=1 15 228 3.0E-62
sp|Q9VY93|MTNB_DROME Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila melanogaster GN=CG11134 PE=2 SV=1 15 228 3.0E-62
sp|B3NVZ7|MTNB_DROER Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila erecta GN=GG17808 PE=3 SV=1 15 228 3.0E-62
sp|B4Q2F5|MTNB_DROYA Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila yakuba GN=GE17104 PE=3 SV=1 15 228 8.0E-62
sp|B4L8M2|MTNB_DROMO Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila mojavensis GN=GI14333 PE=3 SV=1 15 223 1.0E-61
sp|B4NEU3|MTNB_DROWI Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila willistoni GN=GK25216 PE=3 SV=1 15 225 4.0E-61
sp|Q16NX0|MTNB_AEDAE Probable methylthioribulose-1-phosphate dehydratase OS=Aedes aegypti GN=AAEL011830 PE=3 SV=1 15 236 4.0E-61
sp|Q29HV4|MTNB_DROPS Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila pseudoobscura pseudoobscura GN=GA10783 PE=3 SV=2 15 228 3.0E-60
sp|Q6CMZ9|MTNB_KLULA Methylthioribulose-1-phosphate dehydratase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDE1 PE=3 SV=1 21 227 4.0E-60
sp|B4M1W5|MTNB_DROVI Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila virilis GN=GJ19387 PE=3 SV=1 15 228 4.0E-60
sp|B6K0X1|MTNB_SCHJY Methylthioribulose-1-phosphate dehydratase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mde1 PE=3 SV=1 6 226 1.0E-59
sp|Q9HE08|MTNB_SCHPO Methylthioribulose-1-phosphate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde1 PE=3 SV=2 9 229 8.0E-59
sp|B3S866|MTNB_TRIAD Probable methylthioribulose-1-phosphate dehydratase OS=Trichoplax adhaerens GN=TRIADDRAFT_64275 PE=3 SV=1 13 228 7.0E-56
sp|A7RH72|MTNB_NEMVE Probable methylthioribulose-1-phosphate dehydratase OS=Nematostella vectensis GN=v1g197093 PE=3 SV=1 10 228 4.0E-55
sp|C4WU37|MTNB_ACYPI Probable methylthioribulose-1-phosphate dehydratase OS=Acyrthosiphon pisum GN=ACYPI006933 PE=2 SV=1 3 221 4.0E-52
sp|D2VN51|MTNB_NAEGR Probable methylthioribulose-1-phosphate dehydratase OS=Naegleria gruberi GN=NAEGRDRAFT_70372 PE=3 SV=1 12 232 2.0E-48
sp|Q9FN41|MTBC_ARATH Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Arabidopsis thaliana GN=At5g53850 PE=1 SV=1 1 228 6.0E-48
sp|E0CTF3|MTBC2_VITVI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 2 OS=Vitis vinifera GN=VIT_12s0028g03470 PE=2 SV=2 20 228 2.0E-47
sp|B9N1F9|MTBC_POPTR Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Populus trichocarpa GN=POPTR_0001s40980g PE=3 SV=2 20 228 2.0E-47
sp|Q2R483|MTBC_ORYSJ Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Oryza sativa subsp. japonica GN=Os11g0484000 PE=2 SV=1 19 228 3.0E-47
sp|B9SQI7|MTBC_RICCO Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Ricinus communis GN=RCOM_0591060 PE=3 SV=1 20 228 6.0E-47
sp|E0CSI1|MTBC1_VITVI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 OS=Vitis vinifera GN=VIT_19s0014g02480 PE=3 SV=2 15 228 2.0E-46
sp|B8BKI7|MTBC_ORYSI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Oryza sativa subsp. indica GN=OsI_36120 PE=2 SV=1 19 228 6.0E-46
sp|B4G0F3|MTBC_MAIZE Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Zea mays PE=2 SV=1 19 228 2.0E-45
sp|C6JS30|MTBC_SORBI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Sorghum bicolor GN=SORBIDRAFT_0019s002010 PE=3 SV=1 20 228 2.0E-44
sp|A9RBS1|MTBC_PHYPA Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_111231 PE=3 SV=1 9 228 1.0E-43
sp|B4GY79|MTNB_DROPE Probable methylthioribulose-1-phosphate dehydratase OS=Drosophila persimilis GN=GL19864 PE=3 SV=1 15 223 1.0E-42
sp|Q23261|MTNB_CAEEL Probable methylthioribulose-1-phosphate dehydratase OS=Caenorhabditis elegans GN=ZC373.5 PE=3 SV=2 24 233 5.0E-41
sp|A8WRP9|MTNB_CAEBR Probable methylthioribulose-1-phosphate dehydratase OS=Caenorhabditis briggsae GN=CBG01968 PE=3 SV=2 107 233 4.0E-25
sp|Q9UT22|YFY6_SCHPO Methylthioribulose-1-phosphate dehydratase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.06c PE=3 SV=2 19 226 1.0E-21
sp|Q0BPT9|MTNB_GRABC Methylthioribulose-1-phosphate dehydratase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mtnB PE=3 SV=2 14 226 4.0E-15
sp|C0QSI8|MTNB_PERMH Methylthioribulose-1-phosphate dehydratase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mtnB PE=3 SV=1 18 223 2.0E-14
sp|C4KZ52|MTNB_EXISA Methylthioribulose-1-phosphate dehydratase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mtnB PE=3 SV=1 33 228 2.0E-13
sp|A8FCH0|MTNB_BACP2 Methylthioribulose-1-phosphate dehydratase OS=Bacillus pumilus (strain SAFR-032) GN=mtnB PE=3 SV=1 33 223 2.0E-13
sp|Q8EXC1|MTNB_LEPIN Methylthioribulose-1-phosphate dehydratase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mtnB PE=3 SV=1 21 227 4.0E-13
sp|C6DCZ4|MTNB_PECCP Methylthioribulose-1-phosphate dehydratase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mtnB PE=3 SV=1 15 218 2.0E-12
sp|Q60AP7|MTNB_METCA Methylthioribulose-1-phosphate dehydratase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mtnB PE=3 SV=2 32 227 2.0E-12
sp|Q2SKZ2|MTNB_HAHCH Methylthioribulose-1-phosphate dehydratase OS=Hahella chejuensis (strain KCTC 2396) GN=mtnB PE=3 SV=2 28 226 2.0E-12
sp|B2VAA6|MTNB_SULSY Methylthioribulose-1-phosphate dehydratase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=mtnB PE=3 SV=1 19 219 2.0E-12
sp|Q6D1G1|MTNB_PECAS Methylthioribulose-1-phosphate dehydratase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mtnB PE=3 SV=1 15 218 2.0E-12
sp|Q75FG3|MTNB_LEPIC Methylthioribulose-1-phosphate dehydratase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mtnB PE=3 SV=1 21 227 4.0E-12
sp|Q5L1E0|MTNB_GEOKA Methylthioribulose-1-phosphate dehydratase OS=Geobacillus kaustophilus (strain HTA426) GN=mtnB PE=3 SV=1 33 222 8.0E-12
sp|B5XZV4|MTNB_KLEP3 Methylthioribulose-1-phosphate dehydratase OS=Klebsiella pneumoniae (strain 342) GN=mtnB PE=3 SV=1 18 218 1.0E-11
sp|O67788|MTNB_AQUAE Methylthioribulose-1-phosphate dehydratase OS=Aquifex aeolicus (strain VF5) GN=mtnB PE=1 SV=1 30 223 1.0E-11
sp|A4W7Z4|MTNB_ENT38 Methylthioribulose-1-phosphate dehydratase OS=Enterobacter sp. (strain 638) GN=mtnB PE=3 SV=1 25 226 2.0E-11
sp|Q65KJ7|MTNBX_BACLD Bifunctional enzyme MtnB/MtnX OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mtnB/mtnX PE=3 SV=1 33 227 2.0E-11
sp|A6T663|MTNB_KLEP7 Methylthioribulose-1-phosphate dehydratase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mtnB PE=3 SV=1 18 218 2.0E-11
sp|A4ILL7|MTNB_GEOTN Methylthioribulose-1-phosphate dehydratase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnB PE=3 SV=1 19 231 2.0E-11
sp|O31668|MTNB_BACSU Methylthioribulose-1-phosphate dehydratase OS=Bacillus subtilis (strain 168) GN=mtnB PE=1 SV=1 33 227 2.0E-11
sp|Q2P3W4|MTNB_XANOM Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mtnB PE=3 SV=1 32 226 2.0E-11
sp|Q0VPK5|MTNB_ALCBS Methylthioribulose-1-phosphate dehydratase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mtnB PE=3 SV=1 18 226 2.0E-11
sp|Q3ZUZ8|MTNB_CROSK Methylthioribulose-1-phosphate dehydratase OS=Cronobacter sakazakii GN=mtnB PE=3 SV=1 25 222 3.0E-11
sp|A7GS62|MTNB_BACCN Methylthioribulose-1-phosphate dehydratase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtnB PE=3 SV=1 33 223 3.0E-11
sp|Q5H0X8|MTNB_XANOR Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mtnB PE=3 SV=1 32 226 3.0E-11
sp|A7MK09|MTNB_CROS8 Methylthioribulose-1-phosphate dehydratase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mtnB PE=3 SV=1 25 222 3.0E-11
sp|B2SM82|MTNB_XANOP Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mtnB1 PE=3 SV=2 32 226 4.0E-11
sp|A1JP13|MTNB_YERE8 Methylthioribulose-1-phosphate dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mtnB PE=3 SV=2 32 222 6.0E-11
sp|Q5YQZ6|MTNAB_NOCFA Probable bifunctional methylthioribose-1-phosphate isomerase/methylthioribulose-1-phosphate dehydratase OS=Nocardia farcinica (strain IFM 10152) GN=mtnAB PE=3 SV=1 16 225 6.0E-11
sp|Q3IJW1|MTNB_PSEHT Methylthioribulose-1-phosphate dehydratase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mtnB PE=3 SV=1 33 231 7.0E-11
sp|A9VFE1|MTNB_BACWK Methylthioribulose-1-phosphate dehydratase OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnB PE=3 SV=1 33 223 8.0E-11
sp|Q731R0|MTNB_BACC1 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|Q819E6|MTNB_BACCR Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|B7H929|MTNB_BACC4 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain B4264) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|C1EQR3|MTNB_BACC3 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain 03BB102) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|B7JL18|MTNB_BACC0 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain AH820) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|Q81MJ0|MTNB_BACAN Methylthioribulose-1-phosphate dehydratase OS=Bacillus anthracis GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|A0RI44|MTNB_BACAH Methylthioribulose-1-phosphate dehydratase OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|C3LIA8|MTNB_BACAC Methylthioribulose-1-phosphate dehydratase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|C3P747|MTNB_BACAA Methylthioribulose-1-phosphate dehydratase OS=Bacillus anthracis (strain A0248) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|Q6HEC7|MTNB_BACHK Methylthioribulose-1-phosphate dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|A8GAA8|MTNB_SERP5 Methylthioribulose-1-phosphate dehydratase OS=Serratia proteamaculans (strain 568) GN=mtnB PE=3 SV=2 15 222 1.0E-10
sp|B9IWQ1|MTNB_BACCQ Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain Q1) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|B7HN16|MTNB_BACC7 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain AH187) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|Q635P1|MTNB_BACCZ Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain ZK / E33L) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|Q04WK2|MTNB_LEPBL Methylthioribulose-1-phosphate dehydratase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mtnB PE=3 SV=1 24 229 1.0E-10
sp|Q04NC3|MTNB_LEPBJ Methylthioribulose-1-phosphate dehydratase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mtnB PE=3 SV=1 24 229 1.0E-10
sp|B7IWF0|MTNB_BACC2 Methylthioribulose-1-phosphate dehydratase OS=Bacillus cereus (strain G9842) GN=mtnB PE=3 SV=1 89 223 1.0E-10
sp|A4TPN2|MTNB_YERPP Methylthioribulose-1-phosphate dehydratase OS=Yersinia pestis (strain Pestoides F) GN=mtnB PE=3 SV=1 15 234 2.0E-10
sp|A9R2Z8|MTNB_YERPG Methylthioribulose-1-phosphate dehydratase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mtnB PE=3 SV=1 15 234 2.0E-10
sp|A7FLL4|MTNB_YERP3 Methylthioribulose-1-phosphate dehydratase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mtnB PE=3 SV=1 15 234 2.0E-10
sp|Q87C38|MTNB_XYLFT Methylthioribulose-1-phosphate dehydratase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnB PE=3 SV=1 4 226 2.0E-10
sp|B2I5X2|MTNB_XYLF2 Methylthioribulose-1-phosphate dehydratase OS=Xylella fastidiosa (strain M23) GN=mtnB PE=3 SV=1 4 226 2.0E-10
sp|A5FUG4|MTNB_ACICJ Methylthioribulose-1-phosphate dehydratase OS=Acidiphilium cryptum (strain JF-5) GN=mtnB PE=3 SV=2 18 226 2.0E-10
sp|B1JIK6|MTNB_YERPY Methylthioribulose-1-phosphate dehydratase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mtnB PE=3 SV=1 15 234 3.0E-10
sp|Q66E19|MTNB_YERPS Methylthioribulose-1-phosphate dehydratase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mtnB PE=3 SV=1 15 234 3.0E-10
sp|B2K630|MTNB_YERPB Methylthioribulose-1-phosphate dehydratase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mtnB PE=3 SV=1 15 234 3.0E-10
sp|A8ANI0|MTNB_CITK8 Methylthioribulose-1-phosphate dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mtnB PE=3 SV=1 25 226 3.0E-10
sp|B0U3A4|MTNB_XYLFM Methylthioribulose-1-phosphate dehydratase OS=Xylella fastidiosa (strain M12) GN=mtnB PE=3 SV=1 18 226 5.0E-10
sp|Q8P9N3|MTNB_XANCP Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mtnB PE=3 SV=1 18 229 7.0E-10
sp|Q4UU51|MTNB_XANC8 Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mtnB PE=3 SV=1 18 229 7.0E-10
sp|C5D7V1|MTNB_GEOSW Methylthioribulose-1-phosphate dehydratase OS=Geobacillus sp. (strain WCH70) GN=mtnB PE=3 SV=1 33 222 8.0E-10
sp|Q8PLG0|MTNB_XANAC Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mtnB PE=3 SV=1 18 226 8.0E-10
sp|B1XPT3|MTNB_SYNP2 Methylthioribulose-1-phosphate dehydratase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mtnB PE=3 SV=1 43 229 1.0E-09
sp|A1TZ34|MTNB_MARHV Methylthioribulose-1-phosphate dehydratase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mtnB PE=3 SV=1 28 226 1.0E-09
sp|C1DHH0|MTNB_AZOVD Methylthioribulose-1-phosphate dehydratase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mtnB PE=3 SV=1 28 226 1.0E-09
sp|Q9PBD5|MTNB_XYLFA Methylthioribulose-1-phosphate dehydratase OS=Xylella fastidiosa (strain 9a5c) GN=mtnB PE=3 SV=1 18 226 2.0E-09
sp|B0JVQ9|MTNB_MICAN Methylthioribulose-1-phosphate dehydratase OS=Microcystis aeruginosa (strain NIES-843) GN=mtnB PE=3 SV=1 27 230 2.0E-09
sp|B0SU49|MTNB_LEPBP Methylthioribulose-1-phosphate dehydratase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=mtnB PE=3 SV=1 21 219 4.0E-09
sp|B0SII1|MTNB_LEPBA Methylthioribulose-1-phosphate dehydratase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=mtnB PE=3 SV=1 21 219 4.0E-09
sp|B4STR2|MTNB_STRM5 Methylthioribulose-1-phosphate dehydratase OS=Stenotrophomonas maltophilia (strain R551-3) GN=mtnB PE=3 SV=1 18 226 4.0E-09
sp|Q3KFI9|MTNB_PSEPF Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas fluorescens (strain Pf0-1) GN=mtnB PE=3 SV=1 28 218 4.0E-09
sp|B2FPP4|MTNB_STRMK Methylthioribulose-1-phosphate dehydratase OS=Stenotrophomonas maltophilia (strain K279a) GN=mtnB PE=3 SV=1 18 226 5.0E-09
sp|A6V7A8|MTNB_PSEA7 Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnB PE=3 SV=1 28 227 8.0E-09
sp|Q3BUE6|MTNB_XANC5 Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mtnB PE=3 SV=1 18 226 1.0E-08
sp|B7UV38|MTNB_PSEA8 Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnB PE=3 SV=1 28 227 1.0E-08
sp|B0RSM5|MTNB_XANCB Methylthioribulose-1-phosphate dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=mtnB PE=3 SV=1 18 229 2.0E-08
sp|Q48KM8|MTNB_PSE14 Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mtnB PE=3 SV=1 28 223 3.0E-08
sp|Q2NWC8|MTNB_SODGM Methylthioribulose-1-phosphate dehydratase OS=Sodalis glossinidius (strain morsitans) GN=mtnB PE=3 SV=1 18 218 3.0E-08
sp|A7Z3X6|MTNB_BACMF Methylthioribulose-1-phosphate dehydratase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mtnB PE=3 SV=1 33 217 4.0E-08
sp|Q9I342|MTNB_PSEAE Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnB PE=3 SV=1 28 227 5.0E-08
sp|B1YIY0|MTNB_EXIS2 Methylthioribulose-1-phosphate dehydratase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mtnB PE=3 SV=1 21 224 6.0E-08
sp|Q884P3|MTNB_PSESM Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mtnB PE=3 SV=1 28 223 6.0E-08
sp|A7HU86|MTNB_PARL1 Methylthioribulose-1-phosphate dehydratase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mtnB PE=3 SV=2 32 227 1.0E-07
sp|Q02KH3|MTNB_PSEAB Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnB PE=3 SV=1 28 227 1.0E-07
sp|Q5FRJ3|MTNB_GLUOX Methylthioribulose-1-phosphate dehydratase OS=Gluconobacter oxydans (strain 621H) GN=mtnB PE=3 SV=1 32 226 2.0E-07
sp|Q4ZVC0|MTNB_PSEU2 Methylthioribulose-1-phosphate dehydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mtnB PE=3 SV=1 28 223 4.0E-07
sp|A9FCX7|MTNB_SORC5 Methylthioribulose-1-phosphate dehydratase OS=Sorangium cellulosum (strain So ce56) GN=mtnB PE=3 SV=1 32 227 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|591
MLPSPDLLVTSSDPNHPANLIPSLCAKFWSLGWVTGTGGGCSIRDDDLVYIAPSGVQKELLKSSDIYVLSLAAQV
SSTTRTYLRSPPSLKPSQCTPLFLAAFTRRGASCCIHTHSQWAVLVTLLLEAKNSNVFEINNIEQIKAFPRPGHA
NLGFHDTLRVPVIENTPHEEDLTQFLNEAMEKFPDTCAVLVRRHGVYVWGDSVHKAKTQCESLDYLFQLAVEMHK
LSIPCISDIPRIAPDRS*
Coding >OphauG2|591
ATGTTGCCCAGCCCAGATCTCCTCGTCACCTCGTCCGATCCCAATCACCCAGCCAACCTGATTCCCTCGCTCTGC
GCCAAGTTTTGGTCCCTCGGCTGGGTCACCGGCACCGGCGGCGGCTGCTCCATCCGCGACGATGATCTCGTCTAC
ATCGCCCCCTCGGGCGTCCAAAAAGAACTCTTGAAATCCTCCGATATCTACGTCCTCTCCCTCGCCGCCCAAGTC
TCCTCCACTACACGCACCTATCTCCGCTCCCCGCCCTCCCTCAAGCCCTCGCAATGCACGCCACTCTTCCTCGCA
GCCTTTACCCGCCGCGGCGCCAGCTGCTGCATCCACACCCACTCGCAATGGGCCGTCCTCGTCACCCTCCTCCTC
GAGGCAAAGAACAGCAACGTCTTTGAAATCAACAATATCGAACAGATCAAGGCTTTTCCGCGCCCAGGGCATGCC
AATCTCGGCTTTCATGACACCCTTCGCGTCCCAGTCATTGAGAATACGCCGCACGAAGAAGACTTGACCCAATTC
CTCAACGAGGCCATGGAAAAGTTCCCCGATACTTGTGCCGTGCTTGTCCGCAGGCATGGCGTCTATGTATGGGGC
GATAGCGTTCACAAGGCCAAGACGCAGTGCGAAAGCCTCGACTATCTCTTTCAACTCGCTGTCGAAATGCACAAG
CTCAGCATTCCCTGTATAAGTGACATCCCTCGTATAGCTCCCGACCGGTCATAA
Transcript >OphauG2|591
ATGTTGCCCAGCCCAGATCTCCTCGTCACCTCGTCCGATCCCAATCACCCAGCCAACCTGATTCCCTCGCTCTGC
GCCAAGTTTTGGTCCCTCGGCTGGGTCACCGGCACCGGCGGCGGCTGCTCCATCCGCGACGATGATCTCGTCTAC
ATCGCCCCCTCGGGCGTCCAAAAAGAACTCTTGAAATCCTCCGATATCTACGTCCTCTCCCTCGCCGCCCAAGTC
TCCTCCACTACACGCACCTATCTCCGCTCCCCGCCCTCCCTCAAGCCCTCGCAATGCACGCCACTCTTCCTCGCA
GCCTTTACCCGCCGCGGCGCCAGCTGCTGCATCCACACCCACTCGCAATGGGCCGTCCTCGTCACCCTCCTCCTC
GAGGCAAAGAACAGCAACGTCTTTGAAATCAACAATATCGAACAGATCAAGGCTTTTCCGCGCCCAGGGCATGCC
AATCTCGGCTTTCATGACACCCTTCGCGTCCCAGTCATTGAGAATACGCCGCACGAAGAAGACTTGACCCAATTC
CTCAACGAGGCCATGGAAAAGTTCCCCGATACTTGTGCCGTGCTTGTCCGCAGGCATGGCGTCTATGTATGGGGC
GATAGCGTTCACAAGGCCAAGACGCAGTGCGAAAGCCTCGACTATCTCTTTCAACTCGCTGTCGAAATGCACAAG
CTCAGCATTCCCTGTATAAGTGACATCCCTCGTATAGCTCCCGACCGGTCATAA
Gene >OphauG2|591
ATGTTGCCCAGCCCAGATCTCCTCGTCACCTCGTCCGATCCCAATCACCCAGCCAACCTGATTCCCTCGCTCTGC
GCCAAGTTTTGGTCCCTCGGCTGGGTCACCGGCACCGGCGGCGGCTGCTCCATCCGCGACGAGTTTGTCTTTCCA
CTTTCCTTCCATCCTCCCCTCCTCTTCTTCTCTCGACGCTCTTTTGCTCCAACTTTCCCCTCGTCACCGCTTGTC
CACTCTACGCAAAATCAACATTGCTCCCCAAACAAAAAAAAGAAGAGAAAAGAAAGAAAACACTTGAAACCCGTT
GACCCTTAAACCTTGCAGTGATCTCGTCTACATCGCCCCCTCGGGCGTCCAAAAAGAACTCTTGAAATCCTCCGA
TATCTACGTCCTCTCCCTCGCCGCCCAAGTCTCCTCCACTACACGCACCTATCTCCGCTCCCCGCCCTCCCTCAA
GCCCTCGCAATGCACGCCACTCTTCCTCGCAGCCTTTACCCGCCGCGGCGCCAGCTGCTGCATCCACACCCACTC
GCAATGGGCCGTCCTCGTCACCCTCCTCCTCGAGGCAAAGAACAGCAACGTCTTTGAAATCAACAATATCGAACA
GATCAAGGCTTTTCCGCGCCCAGGGCATGCCAATCTCGGCTTTCATGACACCCTTCGCGTCCCAGTCATTGAGAA
TACGCCGCACGAAGAAGACTTGACCCAATTCCTCAACGAGGCCATGGAAAAGTTCCCCGATACTTGTGCCGTGCT
TGTCCGCAGGCATGGCGTCTATGTATGGGGCGATAGCGTTCACAAGGCCAAGACGCAGTGCGAAAGGTATGCTGC
CCCGTATAATGGCGAGCTAATTCTTAAATCTAACAAGCAATGAAGCCTCGACTATCTCTTTCAACTCGCTGTCGA
AATGCACAAGCTCAGCATTCCCTGTATAAGTGACATCCCTCGTATAGCTCCCGACCGGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail