Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5890
Gene name
LocationContig_57:27884..28820
Strand-
Gene length (bp)936
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13578 Methyltransf_24 Methyltransferase domain 1.4E-06 103 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9AJU2|ELMM1_STROV 8-demethyl-8-alpha-L-rhamnosyl tetracenomycin-C 2'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMI PE=1 SV=1 56 265 8.0E-27
sp|Q9ZHQ4|TYLE_STRFR Demethylmacrocin O-methyltransferase OS=Streptomyces fradiae GN=tylE PE=1 SV=1 55 237 2.0E-24
sp|Q83WF2|MYCE_MICGR Mycinamicin VI 2''-O-methyltransferase OS=Micromonospora griseorubida GN=mycE PE=1 SV=1 35 234 3.0E-22
sp|Q9AJU1|ELMM2_STROV 8-demethyl-8-(2-methoxy-alpha-L-rhamnosyl)-tetracenomycin-C 3'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMII PE=1 SV=1 60 237 1.0E-18
sp|O87833|OLEY_STRAT L-olivosyl-oleandolide 3-O-methyltransferase OS=Streptomyces antibioticus GN=oleY PE=1 SV=1 56 237 4.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5890
MVMMNPSRLQLPLLLLTAACFLIAVFHQMGHETAQEIQSKLAKHFGASSQGSQPQPSFEQIALKFGTDKVTDHNY
QDMYEKYVSPLRNNRVKMLEIGLGCNMEYGPGASYYLWLEYLSDVELYYIESERPCADKYKDKTSNAHVFVGDQA
DKAFLDHFAADTTVDGLFDIIIDDGGHTMEQQITSLEHLWPVVKPGGVYIIEDLQTSFWPDFGGDPSTQNRARLT
TMKYIYHAIDDLMVKRESRTISHDLLSVDCMAEICTLQKRK*
Coding >OphauG2|5890
ATGGTCATGATGAATCCGAGCCGCCTCCAGCTTCCCCTTCTATTGCTAACAGCTGCCTGTTTCCTCATCGCCGTC
TTTCATCAAATGGGCCATGAGACGGCTCAGGAAATTCAGAGCAAGCTAGCCAAGCATTTCGGTGCATCGTCTCAA
GGCTCACAGCCACAGCCTTCTTTTGAACAAATCGCCCTCAAATTTGGTACCGACAAGGTGACAGACCACAATTAT
CAGGACATGTACGAAAAGTATGTCTCGCCGCTACGGAACAATCGCGTCAAGATGCTTGAGATAGGCCTTGGTTGC
AACATGGAATATGGACCCGGCGCGTCCTATTACTTATGGCTGGAATATCTCTCCGATGTCGAGCTATACTATATC
GAGTCGGAAAGGCCTTGCGCAGACAAATACAAGGACAAGACTAGCAATGCCCACGTGTTTGTTGGTGACCAGGCC
GACAAGGCCTTTCTCGATCATTTTGCGGCCGACACAACCGTGGACGGCTTGTTTGACATTATAATCGATGACGGT
GGGCACACAATGGAGCAACAGATTACATCTTTGGAACATTTGTGGCCAGTGGTCAAGCCGGGCGGTGTCTACATT
ATTGAAGACCTGCAGACAAGTTTCTGGCCAGACTTTGGTGGCGATCCTTCGACTCAAAATCGAGCCCGTCTCACT
ACAATGAAGTATATCTACCATGCCATTGACGATTTAATGGTAAAGAGGGAGTCGAGGACCATTAGCCATGACCTG
CTGTCAGTAGATTGCATGGCGGAGATTTGCACACTGCAGAAGCGAAAGTAA
Transcript >OphauG2|5890
ATGGTCATGATGAATCCGAGCCGCCTCCAGCTTCCCCTTCTATTGCTAACAGCTGCCTGTTTCCTCATCGCCGTC
TTTCATCAAATGGGCCATGAGACGGCTCAGGAAATTCAGAGCAAGCTAGCCAAGCATTTCGGTGCATCGTCTCAA
GGCTCACAGCCACAGCCTTCTTTTGAACAAATCGCCCTCAAATTTGGTACCGACAAGGTGACAGACCACAATTAT
CAGGACATGTACGAAAAGTATGTCTCGCCGCTACGGAACAATCGCGTCAAGATGCTTGAGATAGGCCTTGGTTGC
AACATGGAATATGGACCCGGCGCGTCCTATTACTTATGGCTGGAATATCTCTCCGATGTCGAGCTATACTATATC
GAGTCGGAAAGGCCTTGCGCAGACAAATACAAGGACAAGACTAGCAATGCCCACGTGTTTGTTGGTGACCAGGCC
GACAAGGCCTTTCTCGATCATTTTGCGGCCGACACAACCGTGGACGGCTTGTTTGACATTATAATCGATGACGGT
GGGCACACAATGGAGCAACAGATTACATCTTTGGAACATTTGTGGCCAGTGGTCAAGCCGGGCGGTGTCTACATT
ATTGAAGACCTGCAGACAAGTTTCTGGCCAGACTTTGGTGGCGATCCTTCGACTCAAAATCGAGCCCGTCTCACT
ACAATGAAGTATATCTACCATGCCATTGACGATTTAATGGTAAAGAGGGAGTCGAGGACCATTAGCCATGACCTG
CTGTCAGTAGATTGCATGGCGGAGATTTGCACACTGCAGAAGCGAAAGTAA
Gene >OphauG2|5890
ATGGTCATGATGAATCCGAGCCGCCTCCAGCTTCCCCTTCTATTGCTAACAGCTGCCTGTTTCCTCATCGCCGTC
TTTCATCAAATGGGCCATGAGACGGCTCAGGAAATTCAGAGCAAGCTAGCCAAGCATTTGTCAGTACCAAACTCA
AGACCAACCAACGCTATACAGGTTCATTGACGAGCTGTCAATGCTTCTTTTGACAGCGGTGCATCGTCTCAAGGC
TCACAGCCACAGCCTTCTTTTGAACAAATCGCCCTCAAATTTGGTACCGACAAGGTGACAGACCACAATTATCAG
GACATGTACGAAAAGTATGTCTCGCCGCTACGGAACAATCGCGTCAAGATGCTTGAGATAGGCCTTGGTTGCAAC
ATGGTGAGCCACTGTTATACAGCCAAGCCAGCGTTGTCCTTTCCAACAATATTGACATGTATCCAGGAATATGGA
CCCGGCGCGTCCTATTACTTATGGCTGGAATATCTCTCCGATGTCGAGCTATACTATATCGAGTCGGAAAGGCCT
TGCGCAGACAAATACAAGGACAAGACTAGCAATGCCCACGTGTTTGTTGGTGACCAGGCCGACAAGGCCTTTCTC
GATCATTTTGCGGCCGACACAACCGTGGACGGCTTGTTTGACATTATAATCGATGACGGTGGGCACACAATGGAG
CAACAGATTACATCTTTGGAACATTTGTGGCCAGTGGTCAAGCCGGGCGGTGTCTACATTATTGAAGACCTGCAG
ACAAGTTTCTGGCCAGACTTTGGTGGCGATCCTTCGACTCAAAATCGAGCCCGTCTCACTACAATGAAGTATATC
TACCATGCCATTGACGATTTAATGGTAAAGAGGGAGTCGAGGACCATTAGCCATGACCTGCTGTCAGTAGATTGC
ATGGCGGAGATTTGCACACTGCAGAAGCGAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail