Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5860
Gene name
LocationContig_566:1377..2649
Strand+
Gene length (bp)1272
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 9 422 1.0E-123
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 101 385 9.0E-61
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 134 399 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5860
MALVWLLLLLLPTAVVSQSVTFSGGTSDLTFIQGSRTPSASPPTGPPTSAYSSYASKVTLTASTSDTTLTATTTW
SGSATTGNNLTQTASTPEPPRNTQPCNNYLELCTRKYSNITNVAAHNSPFVRPGNSGSNQELPVKTQLDDGVRFL
QAQIQWPVNGSVPHFCHTTCDLLDAGPINEWLTQVREWVDMHPFDVVTILLGNGNYSTPDLYVPYIERSGILKYA
YEPPFFPMALADWPTLEDMILRGKRVVMFLDYMADENKYPWLLDQFSQMWETPFDPLDRNFPCVVQRPPDLAPEA
ARDRLYLMNHNLNVDFNIFDTQILVPAVALLNETNAADGTGSVGLAANNCRAEWGRAPNFLNVDYYNYGSPPGSV
FEAAARVNNVTYNRPCCGKVSLAASVAYRSAWQPAMATAAVLAVLLMW*
Coding >OphauG2|5860
ATGGCTCTCGTGTGGCTGCTGCTGCTGCTGCTGCCCACCGCTGTTGTGTCCCAGTCGGTCACGTTTAGCGGTGGC
ACTTCAGACCTGACCTTTATCCAAGGATCGCGCACCCCGTCAGCCTCGCCGCCCACAGGGCCGCCAACAAGTGCC
TACAGCTCCTATGCCTCCAAGGTGACGCTCACAGCATCGACGAGCGACACCACTCTGACGGCCACCACGACATGG
TCAGGCTCCGCGACGACGGGCAACAACTTGACTCAGACGGCATCGACCCCGGAGCCGCCGCGCAACACGCAGCCC
TGCAACAACTATCTCGAGCTCTGCACGCGCAAGTACAGCAACATTACAAACGTGGCCGCCCACAACTCGCCCTTT
GTGCGCCCCGGGAACTCGGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTTGACGATGGAGTTCGCTTCCTG
CAGGCCCAGATACAGTGGCCCGTCAATGGATCCGTCCCGCACTTTTGTCACACGACATGCGATCTGCTGGATGCT
GGGCCCATCAACGAGTGGCTGACGCAGGTCCGCGAATGGGTCGACATGCATCCCTTTGATGTCGTCACCATTCTG
CTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATAGAGCGTTCAGGCATTCTCAAGTACGCA
TACGAGCCGCCCTTTTTCCCCATGGCCCTGGCCGACTGGCCCACTCTCGAGGATATGATTCTGCGTGGCAAGCGC
GTCGTCATGTTCCTCGACTACATGGCCGACGAGAACAAGTATCCCTGGCTCCTCGACCAGTTTTCGCAAATGTGG
GAGACTCCCTTTGATCCCCTGGATCGCAACTTTCCCTGTGTCGTCCAGCGCCCACCCGACCTGGCACCCGAGGCA
GCACGCGACCGTCTCTATCTAATGAACCACAACCTCAATGTCGATTTTAATATCTTTGACACCCAGATCCTGGTG
CCCGCCGTTGCTCTGCTCAACGAGACCAACGCGGCTGATGGCACCGGCAGTGTTGGACTCGCTGCCAACAATTGC
CGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGATTACTACAACTATGGCTCGCCGCCAGGATCTGTC
TTTGAGGCGGCTGCCCGCGTCAATAATGTCACATATAACCGGCCCTGTTGCGGCAAGGTCTCGCTGGCGGCCTCT
GTGGCTTATAGGAGTGCATGGCAGCCAGCAATGGCCACCGCGGCCGTCTTGGCTGTCCTTCTGATGTGGTGA
Transcript >OphauG2|5860
ATGGCTCTCGTGTGGCTGCTGCTGCTGCTGCTGCCCACCGCTGTTGTGTCCCAGTCGGTCACGTTTAGCGGTGGC
ACTTCAGACCTGACCTTTATCCAAGGATCGCGCACCCCGTCAGCCTCGCCGCCCACAGGGCCGCCAACAAGTGCC
TACAGCTCCTATGCCTCCAAGGTGACGCTCACAGCATCGACGAGCGACACCACTCTGACGGCCACCACGACATGG
TCAGGCTCCGCGACGACGGGCAACAACTTGACTCAGACGGCATCGACCCCGGAGCCGCCGCGCAACACGCAGCCC
TGCAACAACTATCTCGAGCTCTGCACGCGCAAGTACAGCAACATTACAAACGTGGCCGCCCACAACTCGCCCTTT
GTGCGCCCCGGGAACTCGGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTTGACGATGGAGTTCGCTTCCTG
CAGGCCCAGATACAGTGGCCCGTCAATGGATCCGTCCCGCACTTTTGTCACACGACATGCGATCTGCTGGATGCT
GGGCCCATCAACGAGTGGCTGACGCAGGTCCGCGAATGGGTCGACATGCATCCCTTTGATGTCGTCACCATTCTG
CTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATAGAGCGTTCAGGCATTCTCAAGTACGCA
TACGAGCCGCCCTTTTTCCCCATGGCCCTGGCCGACTGGCCCACTCTCGAGGATATGATTCTGCGTGGCAAGCGC
GTCGTCATGTTCCTCGACTACATGGCCGACGAGAACAAGTATCCCTGGCTCCTCGACCAGTTTTCGCAAATGTGG
GAGACTCCCTTTGATCCCCTGGATCGCAACTTTCCCTGTGTCGTCCAGCGCCCACCCGACCTGGCACCCGAGGCA
GCACGCGACCGTCTCTATCTAATGAACCACAACCTCAATGTCGATTTTAATATCTTTGACACCCAGATCCTGGTG
CCCGCCGTTGCTCTGCTCAACGAGACCAACGCGGCTGATGGCACCGGCAGTGTTGGACTCGCTGCCAACAATTGC
CGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGATTACTACAACTATGGCTCGCCGCCAGGATCTGTC
TTTGAGGCGGCTGCCCGCGTCAATAATGTCACATATAACCGGCCCTGTTGCGGCAAGGTCTCGCTGGCGGCCTCT
GTGGCTTATAGGAGTGCATGGCAGCCAGCAATGGCCACCGCGGCCGTCTTGGCTGTCCTTCTGATGTGGTGA
Gene >OphauG2|5860
ATGGCTCTCGTGTGGCTGCTGCTGCTGCTGCTGCCCACCGCTGTTGTGTCCCAGTCGGTCACGTTTAGCGGTGGC
ACTTCAGACCTGACCTTTATCCAAGGATCGCGCACCCCGTCAGCCTCGCCGCCCACAGGGCCGCCAACAAGTGCC
TACAGCTCCTATGCCTCCAAGGTGACGCTCACAGCATCGACGAGCGACACCACTCTGACGGCCACCACGACATGG
TCAGGCTCCGCGACGACGGGCAACAACTTGACTCAGACGGCATCGACCCCGGAGCCGCCGCGCAACACGCAGCCC
TGCAACAACTATCTCGAGCTCTGCACGCGCAAGTACAGCAACATTACAAACGTGGCCGCCCACAACTCGCCCTTT
GTGCGCCCCGGGAACTCGGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTTGACGATGGAGTTCGCTTCCTG
CAGGCCCAGATACAGTGGCCCGTCAATGGATCCGTCCCGCACTTTTGTCACACGACATGCGATCTGCTGGATGCT
GGGCCCATCAACGAGTGGCTGACGCAGGTCCGCGAATGGGTCGACATGCATCCCTTTGATGTCGTCACCATTCTG
CTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATAGAGCGTTCAGGCATTCTCAAGTACGCA
TACGAGCCGCCCTTTTTCCCCATGGCCCTGGCCGACTGGCCCACTCTCGAGGATATGATTCTGCGTGGCAAGCGC
GTCGTCATGTTCCTCGACTACATGGCCGACGAGAACAAGTATCCCTGGCTCCTCGACCAGTTTTCGCAAATGTGG
GAGACTCCCTTTGATCCCCTGGATCGCAACTTTCCCTGTGTCGTCCAGCGCCCACCCGACCTGGCACCCGAGGCA
GCACGCGACCGTCTCTATCTAATGAACCACAACCTCAATGTCGATTTTAATATCTTTGACACCCAGATCCTGGTG
CCCGCCGTTGCTCTGCTCAACGAGACCAACGCGGCTGATGGCACCGGCAGTGTTGGACTCGCTGCCAACAATTGC
CGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGATTACTACAACTATGGCTCGCCGCCAGGATCTGTC
TTTGAGGCGGCTGCCCGCGTCAATAATGTCACATATAACCGGCCCTGTTGCGGCAAGGTCTCGCTGGCGGCCTCT
GTGGCTTATAGGAGTGCATGGCAGCCAGCAATGGCCACCGCGGCCGTCTTGGCTGTCCTTCTGATGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail