Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|586
Gene name
LocationContig_114:29091..30235
Strand+
Gene length (bp)1144
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain 1.4E-71 16 204
PF18913 FBPase_C Fructose-1-6-bisphosphatase, C-terminal domain 6.7E-47 208 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP1 PE=1 SV=2 8 333 6.0E-133
sp|Q05079|F16P_KLULA Fructose-1,6-bisphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FBP1 PE=3 SV=2 8 333 8.0E-131
sp|P09202|F16P_SCHPO Fructose-1,6-bisphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fbp1 PE=3 SV=1 8 339 8.0E-124
sp|P46276|F16P2_SOLTU Fructose-1,6-bisphosphatase, cytosolic OS=Solanum tuberosum PE=2 SV=1 12 338 4.0E-120
sp|P46267|F16P2_BRANA Fructose-1,6-bisphosphatase, cytosolic OS=Brassica napus PE=2 SV=1 14 338 8.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP1 PE=1 SV=2 8 333 6.0E-133
sp|Q05079|F16P_KLULA Fructose-1,6-bisphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FBP1 PE=3 SV=2 8 333 8.0E-131
sp|P09202|F16P_SCHPO Fructose-1,6-bisphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fbp1 PE=3 SV=1 8 339 8.0E-124
sp|P46276|F16P2_SOLTU Fructose-1,6-bisphosphatase, cytosolic OS=Solanum tuberosum PE=2 SV=1 12 338 4.0E-120
sp|P46267|F16P2_BRANA Fructose-1,6-bisphosphatase, cytosolic OS=Brassica napus PE=2 SV=1 14 338 8.0E-118
sp|Q9MA79|F16P2_ARATH Fructose-1,6-bisphosphatase, cytosolic OS=Arabidopsis thaliana GN=At1g43670 PE=2 SV=1 1 338 1.0E-117
sp|P14766|F16P2_SPIOL Fructose-1,6-bisphosphatase, cytosolic OS=Spinacia oleracea PE=1 SV=2 7 338 1.0E-116
sp|Q42649|F16P2_BETVU Fructose-1,6-bisphosphatase, cytosolic OS=Beta vulgaris PE=2 SV=2 12 338 3.0E-115
sp|Q9XF47|F16P2_MUSAC Fructose-1,6-bisphosphatase, cytosolic OS=Musa acuminata GN=FBPban1 PE=2 SV=1 8 338 5.0E-115
sp|Q0JHF8|F16P2_ORYSJ Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0866400 PE=2 SV=2 12 338 9.0E-115
sp|A2WXB2|F16P2_ORYSI Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sativa subsp. indica GN=OsI_04558 PE=2 SV=2 12 338 9.0E-115
sp|Q9SDL8|F16P2_ORYCO Fructose-1,6-bisphosphatase, cytosolic OS=Oryza coarctata PE=2 SV=1 12 338 1.0E-114
sp|Q8RW99|F16P2_PEA Fructose-1,6-bisphosphatase, cytosolic OS=Pisum sativum PE=2 SV=1 7 338 8.0E-114
sp|Q43139|F16P2_SACHY Fructose-1,6-bisphosphatase, cytosolic OS=Saccharum hybrid GN=CFBP PE=2 SV=2 1 338 2.0E-112
sp|P46275|F16P1_PEA Fructose-1,6-bisphosphatase, chloroplastic OS=Pisum sativum GN=FBP PE=1 SV=2 13 337 3.0E-97
sp|O64422|F16P1_ORYSJ Fructose-1,6-bisphosphatase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0267300 PE=2 SV=1 8 337 2.0E-95
sp|P00636|F16P1_PIG Fructose-1,6-bisphosphatase 1 OS=Sus scrofa GN=FBP1 PE=1 SV=4 11 339 6.0E-95
sp|P09195|F16P1_WHEAT Fructose-1,6-bisphosphatase, chloroplastic OS=Triticum aestivum GN=FBP PE=2 SV=1 14 337 1.0E-94
sp|P00637|F16P1_RABIT Fructose-1,6-bisphosphatase 1 OS=Oryctolagus cuniculus GN=FBP1 PE=1 SV=4 11 339 1.0E-93
sp|Q3SZB7|F16P1_BOVIN Fructose-1,6-bisphosphatase 1 OS=Bos taurus GN=FBP1 PE=2 SV=3 11 339 2.0E-93
sp|P09199|F16P1_SHEEP Fructose-1,6-bisphosphatase 1 OS=Ovis aries GN=FBP1 PE=1 SV=2 11 339 9.0E-93
sp|Q07204|F16P1_BRANA Fructose-1,6-bisphosphatase, chloroplastic OS=Brassica napus GN=FBP PE=2 SV=1 8 337 2.0E-91
sp|Q8F421|F16PA_LEPIN Fructose-1,6-bisphosphatase class 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=fbp PE=3 SV=2 12 337 4.0E-91
sp|Q72RN8|F16PA_LEPIC Fructose-1,6-bisphosphatase class 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=fbp PE=3 SV=2 12 337 4.0E-91
sp|P22418|F16P1_SPIOL Fructose-1,6-bisphosphatase, chloroplastic OS=Spinacia oleracea PE=1 SV=2 13 337 4.0E-91
sp|Q6RYT0|F16P_DICDI Fructose-1,6-bisphosphatase OS=Dictyostelium discoideum GN=fbp PE=3 SV=1 13 339 5.0E-91
sp|P25851|F16P1_ARATH Fructose-1,6-bisphosphatase, chloroplastic OS=Arabidopsis thaliana GN=FBP PE=1 SV=2 8 337 1.0E-90
sp|Q051E1|F16PA_LEPBL Fructose-1,6-bisphosphatase class 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=fbp PE=3 SV=1 12 337 1.0E-90
sp|Q04T19|F16PA_LEPBJ Fructose-1,6-bisphosphatase class 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=fbp PE=3 SV=1 12 337 1.0E-90
sp|Q9QXD6|F16P1_MOUSE Fructose-1,6-bisphosphatase 1 OS=Mus musculus GN=Fbp1 PE=1 SV=3 5 339 2.0E-90
sp|Q2S8D3|F16PA_HAHCH Fructose-1,6-bisphosphatase class 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fbp PE=3 SV=1 14 337 2.0E-90
sp|P09467|F16P1_HUMAN Fructose-1,6-bisphosphatase 1 OS=Homo sapiens GN=FBP1 PE=1 SV=5 11 339 4.0E-90
sp|P19112|F16P1_RAT Fructose-1,6-bisphosphatase 1 OS=Rattus norvegicus GN=Fbp1 PE=1 SV=2 12 338 2.0E-89
sp|B3QWF5|F16PA_CHLT3 Fructose-1,6-bisphosphatase class 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=fbp PE=3 SV=1 14 339 4.0E-89
sp|A6GWD9|F16PA_FLAPJ Fructose-1,6-bisphosphatase class 1 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=fbp PE=3 SV=1 16 339 4.0E-89
sp|Q9Z1N1|F16P2_RAT Fructose-1,6-bisphosphatase isozyme 2 OS=Rattus norvegicus GN=Fbp2 PE=1 SV=1 12 333 8.0E-89
sp|P70695|F16P2_MOUSE Fructose-1,6-bisphosphatase isozyme 2 OS=Mus musculus GN=Fbp2 PE=1 SV=2 12 333 1.0E-88
sp|Q2KJJ9|F16P2_BOVIN Fructose-1,6-bisphosphatase isozyme 2 OS=Bos taurus GN=FBP2 PE=2 SV=1 5 333 1.0E-88
sp|B5FGE3|F16PA_VIBFM Fructose-1,6-bisphosphatase class 1 OS=Vibrio fischeri (strain MJ11) GN=fbp PE=3 SV=1 12 337 5.0E-88
sp|Q5E887|F16PA_VIBF1 Fructose-1,6-bisphosphatase class 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fbp PE=3 SV=1 12 337 1.0E-87
sp|A7MWE4|F16PA_VIBCB Fructose-1,6-bisphosphatase class 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fbp PE=3 SV=1 16 337 2.0E-87
sp|Q11R22|F16PA_CYTH3 Fructose-1,6-bisphosphatase class 1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=fbp PE=3 SV=1 8 337 5.0E-87
sp|Q9N0J6|F16P2_RABIT Fructose-1,6-bisphosphatase isozyme 2 OS=Oryctolagus cuniculus GN=FBP2 PE=1 SV=1 12 333 5.0E-87
sp|Q87SW0|F16PA_VIBPA Fructose-1,6-bisphosphatase class 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fbp PE=3 SV=1 16 337 6.0E-87
sp|B0SQL1|F16PA_LEPBP Fructose-1,6-bisphosphatase class 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=fbp PE=3 SV=2 6 337 7.0E-87
sp|B0SHG0|F16PA_LEPBA Fructose-1,6-bisphosphatase class 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=fbp PE=3 SV=1 6 337 7.0E-87
sp|A5FMJ5|F16PA_FLAJ1 Fructose-1,6-bisphosphatase class 1 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=fbp PE=3 SV=1 16 337 7.0E-87
sp|B6EPV3|F16PA_ALISL Fructose-1,6-bisphosphatase class 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=fbp PE=3 SV=1 12 337 1.0E-86
sp|C0QTP7|F16PA_PERMH Fructose-1,6-bisphosphatase class 1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fbp PE=3 SV=1 17 337 2.0E-86
sp|Q6LV59|F16PA_PHOPR Fructose-1,6-bisphosphatase class 1 OS=Photobacterium profundum GN=fbp PE=3 SV=2 16 337 4.0E-86
sp|Q7MPD0|F16PA_VIBVY Fructose-1,6-bisphosphatase class 1 OS=Vibrio vulnificus (strain YJ016) GN=fbp PE=3 SV=1 16 337 5.0E-86
sp|Q8DE90|F16PA_VIBVU Fructose-1,6-bisphosphatase class 1 OS=Vibrio vulnificus (strain CMCP6) GN=fbp PE=3 SV=1 16 337 5.0E-86
sp|O00757|F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=Homo sapiens GN=FBP2 PE=1 SV=2 12 333 1.0E-85
sp|C6BTU7|F16PA_DESAD Fructose-1,6-bisphosphatase class 1 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=fbp PE=3 SV=1 12 339 2.0E-85
sp|B2V6E2|F16PA_SULSY Fructose-1,6-bisphosphatase class 1 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fbp PE=3 SV=1 17 339 4.0E-85
sp|Q2W3W0|F16PA_MAGSA Fructose-1,6-bisphosphatase class 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fbp PE=3 SV=1 15 338 4.0E-85
sp|Q3JF33|F16PA_NITOC Fructose-1,6-bisphosphatase class 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fbp PE=3 SV=1 17 339 6.0E-85
sp|B1JMK6|F16PA_YERPY Fructose-1,6-bisphosphatase class 1 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fbp PE=3 SV=2 16 337 8.0E-85
sp|Q66F84|F16PA_YERPS Fructose-1,6-bisphosphatase class 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbp PE=3 SV=1 16 337 8.0E-85
sp|A4TRK7|F16PA_YERPP Fructose-1,6-bisphosphatase class 1 OS=Yersinia pestis (strain Pestoides F) GN=fbp PE=3 SV=1 16 337 8.0E-85
sp|A9R579|F16PA_YERPG Fructose-1,6-bisphosphatase class 1 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fbp PE=3 SV=2 16 337 8.0E-85
sp|B2K2N1|F16PA_YERPB Fructose-1,6-bisphosphatase class 1 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fbp PE=3 SV=2 16 337 8.0E-85
sp|A7FMU7|F16PA_YERP3 Fructose-1,6-bisphosphatase class 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fbp PE=3 SV=1 16 337 8.0E-85
sp|A5F599|F16PA_VIBC3 Fructose-1,6-bisphosphatase class 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fbp PE=3 SV=1 16 337 8.0E-85
sp|C3LRK7|F16PA_VIBCM Fructose-1,6-bisphosphatase class 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fbp PE=3 SV=1 16 337 1.0E-84
sp|Q9KP35|F16PA_VIBCH Fructose-1,6-bisphosphatase class 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbp PE=3 SV=1 16 337 1.0E-84
sp|A1VD23|F16PA_DESVV Fructose-1,6-bisphosphatase class 1 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fbp PE=3 SV=1 15 338 1.0E-84
sp|Q72AZ9|F16PA_DESVH Fructose-1,6-bisphosphatase class 1 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fbp PE=3 SV=1 15 338 1.0E-84
sp|B7VKW7|F16PA_VIBTL Fructose-1,6-bisphosphatase class 1 OS=Vibrio tasmaniensis (strain LGP32) GN=fbp PE=3 SV=1 12 337 1.0E-84
sp|Q6D074|F16PA_PECAS Fructose-1,6-bisphosphatase class 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbp PE=3 SV=1 16 337 2.0E-84
sp|A1WZH0|F16PA_HALHL Fructose-1,6-bisphosphatase class 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=fbp PE=3 SV=1 16 339 2.0E-84
sp|A0M764|F16A2_GRAFK Fructose-1,6-bisphosphatase class 1 2 OS=Gramella forsetii (strain KT0803) GN=fbp2 PE=3 SV=1 16 337 3.0E-84
sp|Q1CEI9|F16PA_YERPN Fructose-1,6-bisphosphatase class 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbp PE=3 SV=1 16 337 3.0E-84
sp|Q0WBC9|F16PA_YERPE Fructose-1,6-bisphosphatase class 1 OS=Yersinia pestis GN=fbp PE=3 SV=1 16 337 3.0E-84
sp|Q1CBY3|F16PA_YERPA Fructose-1,6-bisphosphatase class 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbp PE=3 SV=1 16 337 3.0E-84
sp|B2T699|F16PA_BURPP Fructose-1,6-bisphosphatase class 1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=fbp PE=3 SV=1 16 338 3.0E-84
sp|Q3B5N2|F16PA_CHLL7 Fructose-1,6-bisphosphatase class 1 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fbp PE=3 SV=1 12 339 3.0E-84
sp|Q13V64|F16A1_BURXL Fructose-1,6-bisphosphatase class 1 1 OS=Burkholderia xenovorans (strain LB400) GN=fbp1 PE=3 SV=1 16 338 5.0E-84
sp|Q42796|F16P1_SOYBN Fructose-1,6-bisphosphatase, chloroplastic OS=Glycine max GN=FBP PE=2 SV=1 5 337 6.0E-84
sp|B3ELC6|F16PA_CHLPB Fructose-1,6-bisphosphatase class 1 OS=Chlorobium phaeobacteroides (strain BS1) GN=fbp PE=3 SV=1 13 339 7.0E-84
sp|A0M0J2|F16A1_GRAFK Fructose-1,6-bisphosphatase class 1 1 OS=Gramella forsetii (strain KT0803) GN=fbp1 PE=3 SV=1 16 337 1.0E-83
sp|B4S3F3|F16PA_PROA2 Fructose-1,6-bisphosphatase class 1 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=fbp PE=3 SV=1 13 339 2.0E-83
sp|Q7NVB6|F16PA_CHRVO Fructose-1,6-bisphosphatase class 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fbp PE=3 SV=1 15 338 2.0E-83
sp|A8G8Y2|F16PA_SERP5 Fructose-1,6-bisphosphatase class 1 OS=Serratia proteamaculans (strain 568) GN=fbp PE=3 SV=1 16 337 3.0E-83
sp|A4SDH2|F16PA_CHLPM Fructose-1,6-bisphosphatase class 1 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fbp PE=3 SV=1 12 339 3.0E-83
sp|A6THE3|F16PA_KLEP7 Fructose-1,6-bisphosphatase class 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fbp PE=3 SV=1 16 339 5.0E-83
sp|Q3SFS6|F16PA_THIDA Fructose-1,6-bisphosphatase class 1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fbp PE=3 SV=1 16 338 5.0E-83
sp|Q5P7F8|F16PA_AROAE Fructose-1,6-bisphosphatase class 1 OS=Aromatoleum aromaticum (strain EbN1) GN=fbp PE=3 SV=1 15 339 5.0E-83
sp|B5Y2X3|F16PA_KLEP3 Fructose-1,6-bisphosphatase class 1 OS=Klebsiella pneumoniae (strain 342) GN=fbp PE=3 SV=1 16 339 5.0E-83
sp|B5R9H4|F16PA_SALG2 Fructose-1,6-bisphosphatase class 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fbp PE=3 SV=1 16 337 1.0E-82
sp|A1K430|F16PA_AZOSB Fructose-1,6-bisphosphatase class 1 OS=Azoarcus sp. (strain BH72) GN=fbp PE=3 SV=1 15 339 2.0E-82
sp|Q0AGV1|F16PA_NITEC Fructose-1,6-bisphosphatase class 1 OS=Nitrosomonas eutropha (strain C91) GN=fbp PE=3 SV=1 16 339 2.0E-82
sp|B1YUZ7|F16PA_BURA4 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia ambifaria (strain MC40-6) GN=fbp PE=3 SV=1 16 338 2.0E-82
sp|A9MEY3|F16PA_SALAR Fructose-1,6-bisphosphatase class 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fbp PE=3 SV=1 16 337 2.0E-82
sp|A9AEN5|F16PA_BURM1 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=fbp PE=3 SV=1 16 338 2.0E-82
sp|Q7MYW6|F16PA_PHOLL Fructose-1,6-bisphosphatase class 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbp PE=3 SV=1 16 337 3.0E-82
sp|B2JEJ7|F16A1_BURP8 Fructose-1,6-bisphosphatase class 1 1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=fbp1 PE=3 SV=1 16 338 3.0E-82
sp|A1JIU6|F16PA_YERE8 Fructose-1,6-bisphosphatase class 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fbp PE=3 SV=1 16 337 3.0E-82
sp|B1JXN8|F16PA_BURCC Fructose-1,6-bisphosphatase class 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=fbp PE=3 SV=1 16 338 3.0E-82
sp|A8AMG4|F16PA_CITK8 Fructose-1,6-bisphosphatase class 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fbp PE=3 SV=2 16 337 4.0E-82
sp|Q0BHD7|F16PA_BURCM Fructose-1,6-bisphosphatase class 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=fbp PE=3 SV=1 16 338 4.0E-82
sp|Q3YUB9|F16PA_SHISS Fructose-1,6-bisphosphatase class 1 OS=Shigella sonnei (strain Ss046) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q8ZK67|F16PA_SALTY Fructose-1,6-bisphosphatase class 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B4TT57|F16PA_SALSV Fructose-1,6-bisphosphatase class 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B5BKN5|F16PA_SALPK Fructose-1,6-bisphosphatase class 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|A9N548|F16PA_SALPB Fructose-1,6-bisphosphatase class 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q5PJ74|F16PA_SALPA Fructose-1,6-bisphosphatase class 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B4T3H9|F16PA_SALNS Fructose-1,6-bisphosphatase class 1 OS=Salmonella newport (strain SL254) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B4TFG0|F16PA_SALHS Fructose-1,6-bisphosphatase class 1 OS=Salmonella heidelberg (strain SL476) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B5R0U4|F16PA_SALEP Fructose-1,6-bisphosphatase class 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B5FSC7|F16PA_SALDC Fructose-1,6-bisphosphatase class 1 OS=Salmonella dublin (strain CT_02021853) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q57GG7|F16PA_SALCH Fructose-1,6-bisphosphatase class 1 OS=Salmonella choleraesuis (strain SC-B67) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B5F3E2|F16PA_SALA4 Fructose-1,6-bisphosphatase class 1 OS=Salmonella agona (strain SL483) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q63RX4|F16PA_BURPS Fructose-1,6-bisphosphatase class 1 OS=Burkholderia pseudomallei (strain K96243) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A3NC72|F16PA_BURP6 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia pseudomallei (strain 668) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|Q3JPU4|F16PA_BURP1 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia pseudomallei (strain 1710b) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A3NY10|F16PA_BURP0 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia pseudomallei (strain 1106a) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A1V6R5|F16PA_BURMS Fructose-1,6-bisphosphatase class 1 OS=Burkholderia mallei (strain SAVP1) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|Q62LZ0|F16PA_BURMA Fructose-1,6-bisphosphatase class 1 OS=Burkholderia mallei (strain ATCC 23344) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A2S4W0|F16PA_BURM9 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia mallei (strain NCTC 10229) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A3MHJ7|F16PA_BURM7 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia mallei (strain NCTC 10247) GN=fbp PE=3 SV=1 12 339 1.0E-81
sp|A4JCE2|F16PA_BURVG Fructose-1,6-bisphosphatase class 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=fbp PE=3 SV=1 16 338 1.0E-81
sp|P0A995|F16PA_SHIFL Fructose-1,6-bisphosphatase class 1 OS=Shigella flexneri GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q0SXH4|F16PA_SHIF8 Fructose-1,6-bisphosphatase class 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q328V4|F16PA_SHIDS Fructose-1,6-bisphosphatase class 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q31TG8|F16PA_SHIBS Fructose-1,6-bisphosphatase class 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B2TZ12|F16PA_SHIB3 Fructose-1,6-bisphosphatase class 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q1R324|F16PA_ECOUT Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=fbp PE=3 SV=2 16 337 1.0E-81
sp|B1LRB5|F16PA_ECOSM Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|P0A993|F16PA_ECOLI Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli (strain K12) GN=fbp PE=1 SV=1 16 337 1.0E-81
sp|B1ISX3|F16PA_ECOLC Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|P0A994|F16PA_ECOL6 Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|Q0T9F7|F16PA_ECOL5 Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|A1AJD7|F16PA_ECOK1 Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O1:K1 / APEC GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|A8A7Y7|F16PA_ECOHS Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O9:H4 (strain HS) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B1XEL4|F16PA_ECODH Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli (strain K12 / DH10B) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|A7ZVB0|F16PA_ECO24 Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fbp PE=3 SV=1 16 337 1.0E-81
sp|B4EB94|F16PA_BURCJ Fructose-1,6-bisphosphatase class 1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=fbp PE=3 SV=1 16 338 1.0E-81
sp|A0K5J0|F16PA_BURCH Fructose-1,6-bisphosphatase class 1 OS=Burkholderia cenocepacia (strain HI2424) GN=fbp PE=3 SV=1 16 338 2.0E-81
sp|Q1BY59|F16PA_BURCA Fructose-1,6-bisphosphatase class 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=fbp PE=3 SV=1 16 338 2.0E-81
sp|B5ELA6|F16PA_ACIF5 Fructose-1,6-bisphosphatase class 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fbp PE=3 SV=1 16 339 2.0E-81
sp|A1T0H3|F16PA_PSYIN Fructose-1,6-bisphosphatase class 1 OS=Psychromonas ingrahamii (strain 37) GN=fbp PE=3 SV=1 14 335 2.0E-81
sp|Q9LBE7|F16PA_HYDTE Fructose-1,6-bisphosphatase class 1 OS=Hydrogenophilus thermoluteolus GN=fbp PE=3 SV=1 16 338 2.0E-81
sp|Q2SY57|F16PA_BURTA Fructose-1,6-bisphosphatase class 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fbp PE=3 SV=1 12 339 2.0E-81
sp|A7MM48|F16PA_CROS8 Fructose-1,6-bisphosphatase class 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fbp PE=3 SV=1 16 337 3.0E-81
sp|Q2NW44|F16PA_SODGM Fructose-1,6-bisphosphatase class 1 OS=Sodalis glossinidius (strain morsitans) GN=fbp PE=3 SV=1 16 337 3.0E-81
sp|B2VCY1|F16PA_ERWT9 Fructose-1,6-bisphosphatase class 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fbp PE=3 SV=1 16 337 4.0E-81
sp|B5Z3I7|F16PA_ECO5E Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fbp PE=3 SV=1 16 337 5.0E-81
sp|Q8XCF0|F16PA_ECO57 Fructose-1,6-bisphosphatase class 1 OS=Escherichia coli O157:H7 GN=fbp PE=3 SV=1 16 337 5.0E-81
sp|A4W5X6|F16PA_ENT38 Fructose-1,6-bisphosphatase class 1 OS=Enterobacter sp. (strain 638) GN=fbp PE=3 SV=1 16 337 8.0E-81
sp|A9G6T8|F16PA_SORC5 Fructose-1,6-bisphosphatase class 1 OS=Sorangium cellulosum (strain So ce56) GN=fbp PE=3 SV=1 15 339 9.0E-81
sp|Q46YH7|F16PA_CUPPJ Fructose-1,6-bisphosphatase class 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=fbp PE=3 SV=1 15 338 1.0E-80
sp|Q39IJ4|F16PA_BURL3 Fructose-1,6-bisphosphatase class 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fbp PE=3 SV=1 16 339 2.0E-80
sp|Q21YM7|F16A1_RHOFT Fructose-1,6-bisphosphatase class 1 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fbp1 PE=3 SV=1 16 338 2.0E-80
sp|B3EGL2|F16PA_CHLL2 Fructose-1,6-bisphosphatase class 1 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=fbp PE=3 SV=1 14 339 2.0E-80
sp|Q82WY3|F16PA_NITEU Fructose-1,6-bisphosphatase class 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fbp PE=3 SV=1 16 339 2.0E-80
sp|Q8Z146|F16PA_SALTI Fructose-1,6-bisphosphatase class 1 OS=Salmonella typhi GN=fbp PE=3 SV=1 16 337 3.0E-80
sp|P19911|F16A2_CUPNH Fructose-1,6-bisphosphatase class 1 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=fbp2 PE=3 SV=2 12 338 5.0E-80
sp|Q0KCY0|F16A1_CUPNH Fructose-1,6-bisphosphatase class 1 1 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=fbp1 PE=3 SV=1 15 338 1.0E-79
sp|B3R3R6|F16A1_CUPTR Fructose-1,6-bisphosphatase class 1 1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=fbp1 PE=3 SV=1 15 339 1.0E-79
sp|A6VDM7|F16PA_PSEA7 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas aeruginosa (strain PA7) GN=fbp PE=3 SV=1 15 339 2.0E-79
sp|B4SDN7|F16PA_PELPB Fructose-1,6-bisphosphatase class 1 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=fbp PE=3 SV=1 12 339 2.0E-79
sp|Q8KFG8|F16PA_CHLTE Fructose-1,6-bisphosphatase class 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=fbp PE=3 SV=1 13 339 2.0E-79
sp|P19912|F16A3_CUPNH Fructose-1,6-bisphosphatase class 1 3 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=fbp3 PE=3 SV=2 12 338 3.0E-79
sp|Q30ZN0|F16PA_DESAG Fructose-1,6-bisphosphatase class 1 OS=Desulfovibrio alaskensis (strain G20) GN=fbp PE=3 SV=1 15 339 6.0E-79
sp|B2U8C4|F16PA_RALPJ Fructose-1,6-bisphosphatase class 1 OS=Ralstonia pickettii (strain 12J) GN=fbp PE=3 SV=1 15 338 7.0E-79
sp|A2RQ29|F16PA_HERSE Fructose-1,6-bisphosphatase class 1 OS=Herbaspirillum seropedicae GN=fbp PE=3 SV=1 15 339 7.0E-79
sp|Q9HU73|F16PA_PSEAE Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fbp PE=3 SV=1 15 338 1.0E-78
sp|B7V3K3|F16PA_PSEA8 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas aeruginosa (strain LESB58) GN=fbp PE=3 SV=1 15 338 1.0E-78
sp|Q02EQ6|F16PA_PSEAB Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fbp PE=3 SV=1 15 338 1.0E-78
sp|Q2S1G3|F16A2_SALRD Fructose-1,6-bisphosphatase class 1 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=fbp2 PE=3 SV=2 16 337 1.0E-78
sp|A4SM33|F16PA_AERS4 Fructose-1,6-bisphosphatase class 1 OS=Aeromonas salmonicida (strain A449) GN=fbp PE=3 SV=1 14 339 1.0E-78
sp|P45292|F16PA_HAEIN Fructose-1,6-bisphosphatase class 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbp PE=3 SV=1 16 336 1.0E-78
sp|Q8XXI7|F16PA_RALSO Fructose-1,6-bisphosphatase class 1 OS=Ralstonia solanacearum (strain GMI1000) GN=fbp1 PE=3 SV=1 15 339 1.0E-78
sp|A4VGC9|F16PA_PSEU5 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas stutzeri (strain A1501) GN=fbp PE=3 SV=1 15 339 2.0E-78
sp|A5UCP1|F16PA_HAEIE Fructose-1,6-bisphosphatase class 1 OS=Haemophilus influenzae (strain PittEE) GN=fbp PE=3 SV=1 16 336 2.0E-78
sp|A9BW85|F16PA_DELAS Fructose-1,6-bisphosphatase class 1 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=fbp PE=3 SV=1 15 338 2.0E-78
sp|B0KM65|F16PA_PSEPG Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas putida (strain GB-1) GN=fbp PE=3 SV=1 15 339 6.0E-78
sp|B1J2P7|F16PA_PSEPW Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas putida (strain W619) GN=fbp PE=3 SV=1 15 339 6.0E-78
sp|Q4QL80|F16PA_HAEI8 Fructose-1,6-bisphosphatase class 1 OS=Haemophilus influenzae (strain 86-028NP) GN=fbp PE=3 SV=1 16 336 7.0E-78
sp|B3QQ73|F16PA_CHLP8 Fructose-1,6-bisphosphatase class 1 OS=Chlorobaculum parvum (strain NCIB 8327) GN=fbp PE=3 SV=1 13 339 8.0E-78
sp|Q3AT00|F16PA_CHLCH Fructose-1,6-bisphosphatase class 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=fbp PE=3 SV=1 12 339 8.0E-78
sp|A0KJT2|F16PA_AERHH Fructose-1,6-bisphosphatase class 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fbp PE=3 SV=1 14 339 1.0E-77
sp|C5BMI0|F16PA_TERTT Fructose-1,6-bisphosphatase class 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=fbp PE=3 SV=1 16 337 1.0E-77
sp|A4XPL2|F16PA_PSEMY Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas mendocina (strain ymp) GN=fbp PE=3 SV=1 15 339 1.0E-77
sp|A1BEB4|F16PA_CHLPD Fructose-1,6-bisphosphatase class 1 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=fbp PE=3 SV=1 14 339 2.0E-77
sp|A5WA74|F16PA_PSEP1 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fbp PE=3 SV=1 15 339 2.0E-77
sp|Q88CY9|F16PA_PSEPK Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas putida (strain KT2440) GN=fbp PE=3 SV=1 15 339 2.0E-77
sp|A6VN92|F16PA_ACTSZ Fructose-1,6-bisphosphatase class 1 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=fbp PE=3 SV=1 16 339 3.0E-77
sp|B1XZ11|F16A1_LEPCP Fructose-1,6-bisphosphatase class 1 1 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fbp1 PE=3 SV=1 15 339 3.0E-77
sp|Q1LQ15|F16A1_CUPMC Fructose-1,6-bisphosphatase class 1 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=fbp1 PE=3 SV=1 15 339 4.0E-77
sp|Q1I3Q0|F16PA_PSEE4 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas entomophila (strain L48) GN=fbp PE=3 SV=1 15 339 5.0E-77
sp|Q21UY4|F16A2_RHOFT Fructose-1,6-bisphosphatase class 1 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fbp2 PE=3 SV=1 15 338 7.0E-77
sp|A6SVE7|F16PA_JANMA Fructose-1,6-bisphosphatase class 1 OS=Janthinobacterium sp. (strain Marseille) GN=fbp PE=3 SV=1 15 339 8.0E-77
sp|B4F298|F16PA_PROMH Fructose-1,6-bisphosphatase class 1 OS=Proteus mirabilis (strain HI4320) GN=fbp PE=3 SV=1 16 337 1.0E-76
sp|Q2S2I3|F16A1_SALRD Fructose-1,6-bisphosphatase class 1 1 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=fbp1 PE=3 SV=1 14 327 1.0E-76
sp|A9IQQ8|F16PA_BORPD Fructose-1,6-bisphosphatase class 1 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=fbp PE=3 SV=1 16 338 1.0E-76
sp|B3RBL3|F16A2_CUPTR Fructose-1,6-bisphosphatase class 1 2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=fbp2 PE=3 SV=1 12 339 2.0E-76
sp|Q12D67|F16PA_POLSJ Fructose-1,6-bisphosphatase class 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fbp PE=3 SV=1 12 338 4.0E-76
sp|Q4KJP6|F16PA_PSEF5 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbp PE=3 SV=1 15 339 5.0E-76
sp|Q65S38|F16PA_MANSM Fructose-1,6-bisphosphatase class 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbp PE=3 SV=1 16 337 6.0E-76
sp|Q4ZZI0|F16PA_PSEU2 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fbp PE=3 SV=1 15 339 9.0E-76
sp|C3K7D6|F16PA_PSEFS Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas fluorescens (strain SBW25) GN=fbp PE=3 SV=1 15 339 9.0E-76
sp|A4G2P0|F16PA_HERAR Fructose-1,6-bisphosphatase class 1 OS=Herminiimonas arsenicoxydans GN=fbp PE=3 SV=1 15 339 1.0E-75
sp|Q0A5B1|F16PA_ALKEH Fructose-1,6-bisphosphatase class 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=fbp PE=3 SV=1 15 338 1.0E-75
sp|Q87UX4|F16PA_PSESM Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fbp PE=3 SV=1 15 339 2.0E-75
sp|Q7VZM9|F16PA_BORPE Fructose-1,6-bisphosphatase class 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fbp PE=3 SV=1 16 338 2.0E-75
sp|Q7W7N2|F16PA_BORPA Fructose-1,6-bisphosphatase class 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fbp PE=3 SV=1 16 338 2.0E-75
sp|Q7WL20|F16PA_BORBR Fructose-1,6-bisphosphatase class 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fbp PE=3 SV=1 16 338 2.0E-75
sp|A1WH14|F16PA_VEREI Fructose-1,6-bisphosphatase class 1 OS=Verminephrobacter eiseniae (strain EF01-2) GN=fbp PE=3 SV=1 15 338 2.0E-75
sp|B0BQZ1|F16PA_ACTPJ Fructose-1,6-bisphosphatase class 1 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=fbp PE=3 SV=1 16 339 2.0E-75
sp|B3H282|F16PA_ACTP7 Fructose-1,6-bisphosphatase class 1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=fbp PE=3 SV=1 16 339 2.0E-75
sp|Q48PL3|F16PA_PSE14 Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fbp PE=3 SV=1 15 339 3.0E-75
sp|A2SJJ0|F16A2_METPP Fructose-1,6-bisphosphatase class 1 2 OS=Methylibium petroleiphilum (strain PM1) GN=fbp2 PE=3 SV=1 12 339 4.0E-75
sp|C1DHU3|F16PA_AZOVD Fructose-1,6-bisphosphatase class 1 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=fbp PE=3 SV=1 15 338 5.0E-75
sp|Q9CMA4|F16PA_PASMU Fructose-1,6-bisphosphatase class 1 OS=Pasteurella multocida (strain Pm70) GN=fbp PE=3 SV=1 16 339 6.0E-75
sp|Q1MRF1|F16PA_LAWIP Fructose-1,6-bisphosphatase class 1 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=fbp PE=3 SV=1 15 338 8.0E-75
sp|B0USR6|F16PA_HISS2 Fructose-1,6-bisphosphatase class 1 OS=Histophilus somni (strain 2336) GN=fbp PE=3 SV=1 16 339 9.0E-75
sp|Q0I4Y5|F16PA_HAES1 Fructose-1,6-bisphosphatase class 1 OS=Haemophilus somnus (strain 129Pt) GN=fbp PE=3 SV=1 16 339 9.0E-75
sp|A3N298|F16PA_ACTP2 Fructose-1,6-bisphosphatase class 1 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=fbp PE=3 SV=1 16 339 1.0E-74
sp|Q2KZ46|F16PA_BORA1 Fructose-1,6-bisphosphatase class 1 OS=Bordetella avium (strain 197N) GN=fbp PE=3 SV=1 16 338 2.0E-74
sp|Q47A13|F16A1_DECAR Fructose-1,6-bisphosphatase class 1 1 OS=Dechloromonas aromatica (strain RCB) GN=fbp1 PE=3 SV=1 12 338 3.0E-74
sp|Q7NGN9|F16PA_GLOVI Fructose-1,6-bisphosphatase class 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=fbp PE=3 SV=1 12 339 3.0E-74
sp|A1VL56|F16A1_POLNA Fructose-1,6-bisphosphatase class 1 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=fbp1 PE=3 SV=1 15 338 6.0E-74
sp|A1W9H6|F16PA_ACISJ Fructose-1,6-bisphosphatase class 1 OS=Acidovorax sp. (strain JS42) GN=fbp PE=3 SV=1 12 338 7.0E-74
sp|Q3KJG0|F16PA_PSEPF Fructose-1,6-bisphosphatase class 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbp PE=3 SV=1 15 339 2.0E-73
sp|A1VNR3|F16A2_POLNA Fructose-1,6-bisphosphatase class 1 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=fbp2 PE=3 SV=1 16 338 2.0E-73
sp|B0C7G7|F16A2_ACAM1 Fructose-1,6-bisphosphatase class 1 2 OS=Acaryochloris marina (strain MBIC 11017) GN=fbp2 PE=3 SV=1 18 327 2.0E-73
sp|A1TN89|F16PA_ACIAC Fructose-1,6-bisphosphatase class 1 OS=Acidovorax citrulli (strain AAC00-1) GN=fbp PE=3 SV=1 13 338 3.0E-73
sp|A2SJK3|F16A3_METPP Fructose-1,6-bisphosphatase class 1 3 OS=Methylibium petroleiphilum (strain PM1) GN=fbp3 PE=3 SV=1 16 339 3.0E-73
sp|Q7VN74|F16PA_HAEDU Fructose-1,6-bisphosphatase class 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fbp PE=3 SV=1 16 339 7.0E-73
sp|A9LYX9|F16PA_NEIM0 Fructose-1,6-bisphosphatase class 1 OS=Neisseria meningitidis serogroup C (strain 053442) GN=fbp PE=3 SV=1 16 338 7.0E-73
sp|Q1LN82|F16A2_CUPMC Fructose-1,6-bisphosphatase class 1 2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=fbp2 PE=3 SV=1 16 339 9.0E-73
sp|B2FU10|F16PA_STRMK Fructose-1,6-bisphosphatase class 1 OS=Stenotrophomonas maltophilia (strain K279a) GN=fbp PE=3 SV=1 16 338 1.0E-72
sp|Q3BZI4|F16PA_XANC5 Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fbp PE=3 SV=2 16 338 1.0E-72
sp|B4SR24|F16PA_STRM5 Fructose-1,6-bisphosphatase class 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=fbp PE=3 SV=1 16 338 1.0E-72
sp|A5EVS5|F16PA_DICNV Fructose-1,6-bisphosphatase class 1 OS=Dichelobacter nodosus (strain VCS1703A) GN=fbp PE=3 SV=1 16 337 2.0E-72
sp|Q9JZH1|F16PA_NEIMB Fructose-1,6-bisphosphatase class 1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=3 SV=1 16 338 2.0E-72
sp|Q8DLF2|F16PA_THEEB Fructose-1,6-bisphosphatase class 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=fbp PE=3 SV=1 2 337 3.0E-72
sp|Q5H701|F16PA_XANOR Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fbp PE=3 SV=2 16 338 6.0E-72
sp|B2SUX7|F16PA_XANOP Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=fbp PE=3 SV=1 16 338 6.0E-72
sp|Q2P9K6|F16PA_XANOM Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fbp PE=3 SV=1 16 338 6.0E-72
sp|A1KTU6|F16PA_NEIMF Fructose-1,6-bisphosphatase class 1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=fbp PE=3 SV=1 16 338 8.0E-72
sp|A1IRQ3|F16PA_NEIMA Fructose-1,6-bisphosphatase class 1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 16 338 8.0E-72
sp|Q8PR42|F16PA_XANAC Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fbp PE=3 SV=1 16 338 8.0E-72
sp|Q479X4|F16A2_DECAR Fructose-1,6-bisphosphatase class 1 2 OS=Dechloromonas aromatica (strain RCB) GN=fbp2 PE=3 SV=1 16 338 4.0E-71
sp|Q5QVR9|F16PA_IDILO Fructose-1,6-bisphosphatase class 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fbp PE=3 SV=1 38 339 3.0E-70
sp|B1Y5W3|F16A2_LEPCP Fructose-1,6-bisphosphatase class 1 2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fbp2 PE=3 SV=1 16 338 3.0E-70
sp|A7HYA5|F16PA_PARL1 Fructose-1,6-bisphosphatase class 1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fbp PE=3 SV=1 16 338 4.0E-70
sp|B4RLD4|F16PA_NEIG2 Fructose-1,6-bisphosphatase class 1 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fbp PE=3 SV=2 16 338 5.0E-70
sp|Q5F8C3|F16PA_NEIG1 Fructose-1,6-bisphosphatase class 1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbp PE=3 SV=1 16 338 5.0E-70
sp|Q8PE85|F16PA_XANCP Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fbp PE=3 SV=1 16 338 2.0E-69
sp|B0RLK6|F16PA_XANCB Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=fbp PE=3 SV=1 16 338 2.0E-69
sp|Q4V0I4|F16PA_XANC8 Fructose-1,6-bisphosphatase class 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fbp PE=3 SV=1 16 338 2.0E-69
sp|Q2RRP2|F16PA_RHORT Fructose-1,6-bisphosphatase class 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=fbp PE=3 SV=2 12 339 3.0E-69
sp|P48991|F16PA_NOSS1 Fructose-1,6-bisphosphatase class 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fbp PE=3 SV=1 16 337 4.0E-69
sp|Q3MCI4|F16PA_ANAVT Fructose-1,6-bisphosphatase class 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fbp PE=3 SV=1 16 337 4.0E-69
sp|B3DWS5|F16PA_METI4 Fructose-1,6-bisphosphatase class 1 OS=Methylacidiphilum infernorum (isolate V4) GN=fbp PE=3 SV=1 15 338 6.0E-69
sp|B1WX40|F16PA_CYAA5 Fructose-1,6-bisphosphatase class 1 OS=Cyanothece sp. (strain ATCC 51142) GN=fbp PE=3 SV=1 16 337 7.0E-69
sp|P48847|F16PA_NOSP7 Fructose-1,6-bisphosphatase class 1 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fbp PE=3 SV=1 16 337 9.0E-69
sp|A1S351|F16PA_SHEAM Fructose-1,6-bisphosphatase class 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fbp PE=3 SV=1 24 338 9.0E-69
sp|A6W2V5|F16PA_MARMS Fructose-1,6-bisphosphatase class 1 OS=Marinomonas sp. (strain MWYL1) GN=fbp PE=3 SV=1 48 333 5.0E-68
sp|B1XNG1|F16PA_SYNP2 Fructose-1,6-bisphosphatase class 1 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=fbp PE=3 SV=1 16 337 8.0E-68
sp|P74324|F16PA_SYNY3 Fructose-1,6-bisphosphatase class 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fbp PE=3 SV=1 16 337 2.0E-67
sp|Q1H3T1|F16PA_METFK Fructose-1,6-bisphosphatase class 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fbp PE=3 SV=1 14 338 4.0E-67
sp|Q2JK61|F16PA_SYNJB Fructose-1,6-bisphosphatase class 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fbp PE=3 SV=1 14 334 4.0E-67
sp|Q2JTX5|F16PA_SYNJA Fructose-1,6-bisphosphatase class 1 OS=Synechococcus sp. (strain JA-3-3Ab) GN=fbp PE=3 SV=1 14 334 2.0E-66
sp|Q118F5|F16PA_TRIEI Fructose-1,6-bisphosphatase class 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fbp PE=3 SV=1 16 339 9.0E-66
sp|B0JH56|F16PA_MICAN Fructose-1,6-bisphosphatase class 1 OS=Microcystis aeruginosa (strain NIES-843) GN=fbp PE=3 SV=1 16 337 1.0E-65
sp|Q31FI6|F16PA_THICR Fructose-1,6-bisphosphatase class 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=fbp PE=3 SV=2 31 338 5.0E-65
sp|B0VT80|F16PA_ACIBS Fructose-1,6-bisphosphatase class 1 OS=Acinetobacter baumannii (strain SDF) GN=fbp PE=3 SV=1 15 338 9.0E-65
sp|B2HWU2|F16PA_ACIBC Fructose-1,6-bisphosphatase class 1 OS=Acinetobacter baumannii (strain ACICU) GN=fbp PE=3 SV=1 15 338 9.0E-65
sp|Q9A8G9|F16PA_CAUCR Fructose-1,6-bisphosphatase class 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fbp PE=3 SV=1 49 335 1.0E-64
sp|B0VDK0|F16PA_ACIBY Fructose-1,6-bisphosphatase class 1 OS=Acinetobacter baumannii (strain AYE) GN=fbp PE=3 SV=1 15 338 1.0E-64
sp|B4S2E8|F16PA_ALTMD Fructose-1,6-bisphosphatase class 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=fbp PE=3 SV=1 25 332 4.0E-64
sp|Q13QU8|F16A2_BURXL Fructose-1,6-bisphosphatase class 1 2 OS=Burkholderia xenovorans (strain LB400) GN=fbp2 PE=3 SV=1 45 338 7.0E-64
sp|B0CAD9|F16A1_ACAM1 Fructose-1,6-bisphosphatase class 1 1 OS=Acaryochloris marina (strain MBIC 11017) GN=fbp1 PE=3 SV=1 16 337 1.0E-63
sp|Q6F982|F16PA_ACIAD Fructose-1,6-bisphosphatase class 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fbp PE=3 SV=1 15 338 2.0E-63
sp|A3M7W9|F16PA_ACIBT Fructose-1,6-bisphosphatase class 1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fbp PE=3 SV=2 15 338 3.0E-63
sp|Q5N163|F16PA_SYNP6 Fructose-1,6-bisphosphatase class 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fbp PE=3 SV=2 16 335 3.0E-63
sp|Q59943|F16PA_SYNE7 Fructose-1,6-bisphosphatase class 1 OS=Synechococcus elongatus (strain PCC 7942) GN=fbp PE=1 SV=2 16 335 3.0E-63
sp|A9L375|F16PA_SHEB9 Fructose-1,6-bisphosphatase class 1 OS=Shewanella baltica (strain OS195) GN=fbp PE=3 SV=1 47 338 3.0E-62
sp|A5WGK6|F16PA_PSYWF Fructose-1,6-bisphosphatase class 1 OS=Psychrobacter sp. (strain PRwf-1) GN=fbp PE=3 SV=1 47 339 1.0E-61
sp|Q21L89|F16PA_SACD2 Fructose-1,6-bisphosphatase class 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=fbp PE=3 SV=1 27 337 2.0E-61
sp|A6WSQ6|F16PA_SHEB8 Fructose-1,6-bisphosphatase class 1 OS=Shewanella baltica (strain OS185) GN=fbp PE=3 SV=1 47 338 2.0E-61
sp|A0KSW7|F16PA_SHESA Fructose-1,6-bisphosphatase class 1 OS=Shewanella sp. (strain ANA-3) GN=fbp PE=3 SV=1 47 338 2.0E-60
sp|Q0HRA0|F16PA_SHESR Fructose-1,6-bisphosphatase class 1 OS=Shewanella sp. (strain MR-7) GN=fbp PE=3 SV=1 38 338 3.0E-60
sp|Q15ZB4|F16PA_PSEA6 Fructose-1,6-bisphosphatase class 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fbp PE=3 SV=1 47 339 3.0E-60
sp|Q8EAB6|F16PA_SHEON Fructose-1,6-bisphosphatase class 1 OS=Shewanella oneidensis (strain MR-1) GN=fbp PE=3 SV=1 47 338 4.0E-60
sp|Q0HMI8|F16PA_SHESM Fructose-1,6-bisphosphatase class 1 OS=Shewanella sp. (strain MR-4) GN=fbp PE=3 SV=1 38 338 5.0E-60
sp|B0T0R1|F16PA_CAUSK Fructose-1,6-bisphosphatase class 1 OS=Caulobacter sp. (strain K31) GN=fbp PE=3 SV=1 31 334 7.0E-60
sp|A3D0P6|F16PA_SHEB5 Fructose-1,6-bisphosphatase class 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fbp PE=3 SV=1 47 338 1.0E-59
sp|A3QAZ7|F16PA_SHELP Fructose-1,6-bisphosphatase class 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fbp PE=3 SV=1 38 338 1.0E-59
sp|A1RNR2|F16PA_SHESW Fructose-1,6-bisphosphatase class 1 OS=Shewanella sp. (strain W3-18-1) GN=fbp PE=3 SV=1 47 338 2.0E-59
sp|A8H0H1|F16PA_SHEPA Fructose-1,6-bisphosphatase class 1 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fbp PE=3 SV=1 38 338 3.0E-59
sp|Q3IFQ5|F16A1_PSEHT Fructose-1,6-bisphosphatase class 1 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fbp1 PE=3 SV=1 38 339 4.0E-59
sp|Q47VB1|F16PA_COLP3 Fructose-1,6-bisphosphatase class 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fbp PE=3 SV=1 34 338 4.0E-59
sp|Q12JW2|F16PA_SHEDO Fructose-1,6-bisphosphatase class 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fbp PE=3 SV=1 38 338 5.0E-59
sp|B3ERE1|F16PA_AMOA5 Fructose-1,6-bisphosphatase class 1 OS=Amoebophilus asiaticus (strain 5a2) GN=fbp PE=3 SV=1 10 327 7.0E-59
sp|B1KEL4|F16PA_SHEWM Fructose-1,6-bisphosphatase class 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fbp PE=3 SV=1 30 338 9.0E-59
sp|A8FRF1|F16PA_SHESH Fructose-1,6-bisphosphatase class 1 OS=Shewanella sediminis (strain HAW-EB3) GN=fbp PE=3 SV=1 35 338 2.0E-58
sp|B0TTL6|F16PA_SHEHH Fructose-1,6-bisphosphatase class 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=fbp PE=3 SV=1 38 338 2.0E-58
sp|A4Y373|F16PA_SHEPC Fructose-1,6-bisphosphatase class 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fbp PE=3 SV=1 47 338 3.0E-58
sp|Q088C3|F16PA_SHEFN Fructose-1,6-bisphosphatase class 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=fbp PE=3 SV=1 35 338 2.0E-56
sp|B3PGC8|F16PA_CELJU Fructose-1,6-bisphosphatase class 1 OS=Cellvibrio japonicus (strain Ueda107) GN=fbp PE=3 SV=1 26 332 3.0E-56
sp|Q4FUA6|F16PA_PSYA2 Fructose-1,6-bisphosphatase class 1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fbp PE=3 SV=1 47 338 8.0E-56
sp|Q213I9|F16PA_RHOPB Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=fbp PE=3 SV=1 53 339 9.0E-56
sp|Q3ICJ5|F16A3_PSEHT Fructose-1,6-bisphosphatase class 1 3 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fbp3 PE=3 SV=1 25 337 8.0E-55
sp|A4SWM3|F16PA_POLSQ Fructose-1,6-bisphosphatase class 1 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=fbp PE=3 SV=1 19 338 1.0E-54
sp|Q1QDE0|F16PA_PSYCK Fructose-1,6-bisphosphatase class 1 OS=Psychrobacter cryohalolentis (strain K5) GN=fbp PE=3 SV=1 47 338 2.0E-54
sp|Q1QGD7|F16A2_NITHX Fructose-1,6-bisphosphatase class 1 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fbp2 PE=3 SV=1 55 338 2.0E-54
sp|Q2J1K3|F16PA_RHOP2 Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=fbp PE=3 SV=1 49 338 2.0E-54
sp|B1XVF7|F16PA_POLNS Fructose-1,6-bisphosphatase class 1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=fbp PE=3 SV=1 38 338 1.0E-53
sp|Q1QH19|F16A1_NITHX Fructose-1,6-bisphosphatase class 1 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fbp1 PE=3 SV=1 55 338 1.0E-53
sp|Q9EXV4|F16PA_RHIME Fructose-1,6-bisphosphatase class 1 OS=Rhizobium meliloti (strain 1021) GN=fbp PE=3 SV=2 16 338 1.0E-53
sp|B1Z939|F16PA_METPB Fructose-1,6-bisphosphatase class 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fbp PE=3 SV=1 29 338 3.0E-53
sp|Q3SP44|F16PA_NITWN Fructose-1,6-bisphosphatase class 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fbp PE=3 SV=1 55 338 5.0E-53
sp|A8I541|F16PA_AZOC5 Fructose-1,6-bisphosphatase class 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fbp PE=3 SV=1 15 338 7.0E-53
sp|A7IL64|F16A2_XANP2 Fructose-1,6-bisphosphatase class 1 2 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=fbp2 PE=3 SV=1 69 338 1.0E-52
sp|Q07N65|F16PA_RHOP5 Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=fbp PE=3 SV=1 49 338 2.0E-52
sp|B7L270|F16PA_METC4 Fructose-1,6-bisphosphatase class 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fbp PE=3 SV=1 49 338 5.0E-52
sp|A9W1C8|F16PA_METEP Fructose-1,6-bisphosphatase class 1 OS=Methylobacterium extorquens (strain PA1) GN=fbp PE=3 SV=1 49 338 6.0E-52
sp|Q3IH61|F16A2_PSEHT Fructose-1,6-bisphosphatase class 1 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fbp2 PE=3 SV=1 34 327 1.0E-51
sp|B3QB72|F16PA_RHOPT Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=fbp PE=3 SV=1 49 338 2.0E-51
sp|Q6N0W5|F16PA_RHOPA Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fbp PE=3 SV=1 49 338 2.0E-51
sp|A2SFV4|F16A1_METPP Fructose-1,6-bisphosphatase class 1 1 OS=Methylibium petroleiphilum (strain PM1) GN=fbp1 PE=3 SV=1 58 339 3.0E-51
sp|Q8D275|F16PA_WIGBR Fructose-1,6-bisphosphatase class 1 OS=Wigglesworthia glossinidia brevipalpis GN=fbp PE=3 SV=1 14 337 7.0E-51
sp|P56886|F16PA_SINMW Fructose-1,6-bisphosphatase class 1 OS=Sinorhizobium medicae (strain WSM419) GN=fbp PE=3 SV=2 16 338 9.0E-51
sp|B1LUU9|F16PA_METRJ Fructose-1,6-bisphosphatase class 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fbp PE=3 SV=1 49 338 2.0E-50
sp|P37099|F16PA_NITVU Fructose-1,6-bisphosphatase class 1 OS=Nitrobacter vulgaris GN=fbp PE=3 SV=1 55 338 5.0E-50
sp|A5E987|F16A1_BRASB Fructose-1,6-bisphosphatase class 1 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fbp1 PE=3 SV=1 41 338 8.0E-50
sp|A3PNY0|F16A1_RHOS1 Fructose-1,6-bisphosphatase class 1 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=fbp1 PE=3 SV=1 60 338 2.0E-49
sp|A4WW38|F16A1_RHOS5 Fructose-1,6-bisphosphatase class 1 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fbp1 PE=3 SV=1 60 338 3.0E-49
sp|Q3IYB9|F16A1_RHOS4 Fructose-1,6-bisphosphatase class 1 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fbp1 PE=3 SV=1 60 338 6.0E-49
sp|A3PRW1|F16A2_RHOS1 Fructose-1,6-bisphosphatase class 1 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=fbp2 PE=3 SV=1 49 338 7.0E-49
sp|P22780|F16A2_RHOSH Fructose-1,6-bisphosphatase class 1 2 OS=Rhodobacter sphaeroides GN=fbp2 PE=3 SV=2 49 338 2.0E-48
sp|Q3IX60|F16A2_RHOS4 Fructose-1,6-bisphosphatase class 1 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fbp2 PE=3 SV=1 49 338 2.0E-48
sp|A5EQ67|F16A2_BRASB Fructose-1,6-bisphosphatase class 1 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fbp2 PE=3 SV=1 29 339 6.0E-48
sp|P23014|F16PA_XANFL Fructose-1,6-bisphosphatase class 1 OS=Xanthobacter flavus GN=fbp PE=3 SV=1 15 338 8.0E-48
sp|A1B2P8|F16PA_PARDP Fructose-1,6-bisphosphatase class 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=fbp PE=3 SV=1 40 339 1.0E-47
sp|A4YNQ7|F16PA_BRASO Fructose-1,6-bisphosphatase class 1 OS=Bradyrhizobium sp. (strain ORS278) GN=fbp PE=3 SV=1 31 339 1.0E-47
sp|P27994|F16A1_RHOSH Fructose-1,6-bisphosphatase class 1 1 OS=Rhodobacter sphaeroides GN=fbp1 PE=3 SV=1 60 338 3.0E-47
sp|A5FWQ8|F16PA_ACICJ Fructose-1,6-bisphosphatase class 1 OS=Acidiphilium cryptum (strain JF-5) GN=fbp PE=3 SV=1 38 339 1.0E-45
sp|A7IGL7|F16A1_XANP2 Fructose-1,6-bisphosphatase class 1 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=fbp1 PE=3 SV=1 15 338 2.0E-45
sp|Q8GKS1|F16PA_BRADU Fructose-1,6-bisphosphatase class 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fbp PE=3 SV=1 58 338 6.0E-45
sp|Q13CA1|F16PA_RHOPS Fructose-1,6-bisphosphatase class 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=fbp PE=3 SV=1 49 338 7.0E-45
sp|A4WZQ4|F16A2_RHOS5 Fructose-1,6-bisphosphatase class 1 2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fbp2 PE=3 SV=1 49 338 8.0E-45
sp|Q3A5T0|F16PA_PELCD Fructose-1,6-bisphosphatase class 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=fbp PE=3 SV=1 15 332 3.0E-42
sp|O34011|F16PA_RHOCB Fructose-1,6-bisphosphatase class 1 OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=fbp PE=3 SV=2 68 338 7.0E-42
sp|A1APW8|F16PA_PELPD Fructose-1,6-bisphosphatase class 1 OS=Pelobacter propionicus (strain DSM 2379) GN=fbp PE=3 SV=1 37 337 2.0E-41
sp|A6Q9C9|F16PA_SULNB Fructose-1,6-bisphosphatase class 1 OS=Sulfurovum sp. (strain NBC37-1) GN=fbp PE=3 SV=1 40 336 5.0E-41
sp|B3E2M3|F16PA_GEOLS Fructose-1,6-bisphosphatase class 1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fbp PE=3 SV=1 27 337 2.0E-40
sp|B5EFV5|F16PA_GEOBB Fructose-1,6-bisphosphatase class 1 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fbp PE=3 SV=1 52 337 5.0E-39
sp|Q2FM20|F16PA_METHJ Fructose-1,6-bisphosphatase class 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=fbp PE=3 SV=1 53 339 1.0E-38
sp|A6Q349|F16PA_NITSB Fructose-1,6-bisphosphatase class 1 OS=Nitratiruptor sp. (strain SB155-2) GN=fbp PE=3 SV=1 36 338 6.0E-38
sp|A5G439|F16PA_GEOUR Fructose-1,6-bisphosphatase class 1 OS=Geobacter uraniireducens (strain Rf4) GN=fbp PE=3 SV=1 52 337 6.0E-38
sp|Q9HRI1|F16PA_HALSA Fructose-1,6-bisphosphatase class 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fbp PE=3 SV=1 55 329 1.0E-37
sp|B0R3Y1|F16PA_HALS3 Fructose-1,6-bisphosphatase class 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fbp PE=3 SV=1 55 329 1.0E-37
sp|Q5V3Z1|F16A1_HALMA Fructose-1,6-bisphosphatase class 1 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fbp1 PE=3 SV=1 53 335 1.0E-36
sp|Q74CM2|F16PA_GEOSL Fructose-1,6-bisphosphatase class 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fbp PE=3 SV=1 27 337 2.0E-36
sp|A7GXH6|F16PA_CAMC5 Fructose-1,6-bisphosphatase class 1 OS=Campylobacter curvus (strain 525.92) GN=fbp PE=3 SV=1 45 338 2.0E-36
sp|A2ST39|F16PA_METLZ Fructose-1,6-bisphosphatase class 1 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fbp PE=3 SV=2 55 335 4.0E-36
sp|A1VZI4|F16PA_CAMJJ Fructose-1,6-bisphosphatase class 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fbp PE=3 SV=1 62 334 1.0E-35
sp|Q0PA50|F16PA_CAMJE Fructose-1,6-bisphosphatase class 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fbp PE=3 SV=1 62 334 1.0E-35
sp|Q5HUV6|F16PA_CAMJR Fructose-1,6-bisphosphatase class 1 OS=Campylobacter jejuni (strain RM1221) GN=fbp PE=3 SV=1 62 334 2.0E-35
sp|A7H3L9|F16PA_CAMJD Fructose-1,6-bisphosphatase class 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=fbp PE=3 SV=1 62 334 4.0E-35
sp|A7ZCB2|F16PA_CAMC1 Fructose-1,6-bisphosphatase class 1 OS=Campylobacter concisus (strain 13826) GN=fbp PE=3 SV=1 47 339 4.0E-35
sp|Q8FVG9|F16PA_BRUSU Fructose-1,6-bisphosphatase class 1 OS=Brucella suis biovar 1 (strain 1330) GN=fbp PE=3 SV=1 69 337 4.0E-35
sp|A9MCF4|F16PA_BRUC2 Fructose-1,6-bisphosphatase class 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fbp PE=3 SV=1 69 337 5.0E-35
sp|A8EU55|F16PA_ARCB4 Fructose-1,6-bisphosphatase class 1 OS=Arcobacter butzleri (strain RM4018) GN=fbp PE=3 SV=1 62 339 7.0E-35
sp|A9WZF8|F16PA_BRUSI Fructose-1,6-bisphosphatase class 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|Q8YCV6|F16PA_BRUME Fructose-1,6-bisphosphatase class 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|C0RM19|F16PA_BRUMB Fructose-1,6-bisphosphatase class 1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|Q578Z3|F16PA_BRUAB Fructose-1,6-bisphosphatase class 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|Q2YIQ9|F16PA_BRUA2 Fructose-1,6-bisphosphatase class 1 OS=Brucella abortus (strain 2308) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|B2SAG4|F16PA_BRUA1 Fructose-1,6-bisphosphatase class 1 OS=Brucella abortus (strain S19) GN=fbp PE=3 SV=1 69 337 7.0E-35
sp|A7I8R6|F16PA_METB6 Fructose-1,6-bisphosphatase class 1 OS=Methanoregula boonei (strain 6A8) GN=fbp PE=3 SV=1 56 335 2.0E-34
sp|Q39UC4|F16PA_GEOMG Fructose-1,6-bisphosphatase class 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fbp PE=3 SV=1 52 337 2.0E-34
sp|A8FLP9|F16PA_CAMJ8 Fructose-1,6-bisphosphatase class 1 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=fbp PE=3 SV=1 62 334 2.0E-34
sp|A6X307|F16PA_OCHA4 Fructose-1,6-bisphosphatase class 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=fbp PE=3 SV=1 49 337 3.0E-34
sp|A5VVE8|F16PA_BRUO2 Fructose-1,6-bisphosphatase class 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fbp PE=3 SV=1 69 337 5.0E-34
sp|B2JX47|F16A3_BURP8 Fructose-1,6-bisphosphatase class 1 3 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=fbp3 PE=3 SV=1 15 339 6.0E-34
sp|Q3ISJ9|F16PA_NATPD Fructose-1,6-bisphosphatase class 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fbp PE=3 SV=1 69 335 1.0E-33
sp|Q2LUC0|F16PA_SYNAS Fructose-1,6-bisphosphatase class 1 OS=Syntrophus aciditrophicus (strain SB) GN=fbp PE=3 SV=1 16 327 1.0E-33
sp|B2JVN8|F16A2_BURP8 Fructose-1,6-bisphosphatase class 1 2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=fbp2 PE=3 SV=1 49 339 1.0E-33
sp|Q7MAI9|F16PA_WOLSU Fructose-1,6-bisphosphatase class 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=fbp PE=3 SV=1 67 339 3.0E-33
sp|A7I1B8|F16PA_CAMHC Fructose-1,6-bisphosphatase class 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=fbp PE=3 SV=1 38 338 5.0E-32
sp|Q7VGH7|F16PA_HELHP Fructose-1,6-bisphosphatase class 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=fbp PE=3 SV=1 62 339 6.0E-32
sp|A0RP36|F16PA_CAMFF Fructose-1,6-bisphosphatase class 1 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=fbp PE=3 SV=1 63 338 3.0E-31
sp|B0UEK2|F16PA_METS4 Fructose-1,6-bisphosphatase class 1 OS=Methylobacterium sp. (strain 4-46) GN=fbp PE=3 SV=1 66 338 7.0E-31
sp|Q5V311|F16A2_HALMA Fructose-1,6-bisphosphatase class 1 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fbp2 PE=3 SV=2 42 332 3.0E-29
sp|Q18J03|F16PA_HALWD Fructose-1,6-bisphosphatase class 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=fbp PE=3 SV=1 69 335 5.0E-28
sp|Q30RP0|F16PA_SULDN Fructose-1,6-bisphosphatase class 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=fbp PE=3 SV=1 45 338 8.0E-28
sp|P46283|S17P_ARATH Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Arabidopsis thaliana GN=At3g55800 PE=2 SV=1 37 336 5.0E-23
sp|P46284|S17P_CHLRE Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Chlamydomonas reinhardtii GN=CSBP PE=2 SV=1 47 337 9.0E-22
sp|O20252|S17P_SPIOL Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Spinacia oleracea PE=2 SV=1 45 336 1.0E-20
sp|P46285|S17P_WHEAT Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Triticum aestivum PE=2 SV=1 37 336 5.0E-19
sp|B5Z9G5|F16PA_HELPG Fructose-1,6-bisphosphatase class 1 OS=Helicobacter pylori (strain G27) GN=fbp PE=3 SV=1 69 339 3.0E-17
sp|Q9ZJ74|F16PA_HELPJ Fructose-1,6-bisphosphatase class 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fbp PE=3 SV=1 69 332 5.0E-17
sp|B2UVU9|F16PA_HELPS Fructose-1,6-bisphosphatase class 1 OS=Helicobacter pylori (strain Shi470) GN=fbp PE=3 SV=1 69 339 6.0E-17
sp|Q17V54|F16PA_HELAH Fructose-1,6-bisphosphatase class 1 OS=Helicobacter acinonychis (strain Sheeba) GN=fbp PE=3 SV=1 69 339 1.0E-16
sp|O25936|F16PA_HELPY Fructose-1,6-bisphosphatase class 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fbp PE=3 SV=1 69 339 4.0E-16
sp|Q1CR72|F16PA_HELPH Fructose-1,6-bisphosphatase class 1 OS=Helicobacter pylori (strain HPAG1) GN=fbp PE=3 SV=1 69 332 5.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2846
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|586 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|908
Ophiocordyceps camponoti-floridani Ophcf2|01515
Ophiocordyceps camponoti-rufipedis Ophun1|219
Ophiocordyceps kimflemingae Ophio5|6964
Ophiocordyceps subramaniannii Hirsu2|4657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|586
MDQNGNGEKVNTQIVTLTRFLNEEQTKHRDASGDFTLLCHALQFSFKSIAYYIRRATLVNLTGLAGSSNSTGDDQ
KKLDVISNDLFIEAMRSSGKCALLVSEEEDQVIFFPEAHGARYAVACDPIDGSSNLDAGVSVGTIFAVHKLPEGS
TGTKEDVLKPGTELVAAGFTMYGASAQLVLTIKGSSVNGFTLDNGIGEFILTHPKMQMPRSRHIYSVNEGNSLYW
EKPTIDYFESLKQAQDDGKPYSSRYIGSMVADAYRTLLYGGIFAYPADKKSPKGKLRILYECAPMAMVFENAGGQ
ALDSNMRRMLDVCPEHIHDRSGIFMGSWDEMEKVKQFHK*
Coding >OphauG2|586
ATGGATCAAAACGGCAACGGCGAAAAGGTTAATACACAAATCGTCACTCTGACGCGCTTTCTCAACGAGGAGCAG
ACCAAGCACAGGGATGCGTCGGGTGATTTCACCCTCCTCTGCCATGCCCTTCAATTCTCTTTCAAGTCGATTGCC
TATTACATTCGCCGCGCCACCTTGGTCAACTTGACGGGCTTGGCCGGCTCGTCAAACAGTACTGGCGACGACCAG
AAGAAACTCGACGTCATCTCCAACGACCTCTTTATCGAGGCCATGCGTTCCTCAGGAAAGTGTGCGCTGCTTGTT
TCAGAGGAGGAGGACCAGGTCATCTTCTTCCCCGAGGCGCATGGCGCGCGCTACGCTGTGGCATGTGATCCCATT
GACGGATCGTCCAATCTCGATGCTGGCGTTTCTGTAGGGACTATCTTTGCCGTGCACAAGCTGCCCGAAGGGTCG
ACTGGCACCAAGGAAGATGTTCTCAAGCCCGGCACCGAGCTTGTCGCTGCTGGCTTCACCATGTATGGTGCGTCG
GCGCAGCTTGTGCTCACCATCAAGGGCAGCTCCGTCAATGGCTTTACCCTGGACAATGGAATCGGCGAGTTCATC
CTGACGCACCCTAAAATGCAGATGCCGCGCTCGCGCCATATTTACTCGGTCAATGAAGGCAACTCGCTCTACTGG
GAGAAGCCCACCATTGACTACTTTGAGTCGCTCAAGCAGGCTCAGGACGACGGCAAGCCTTATAGTTCCCGTTAT
ATTGGCAGCATGGTTGCGGATGCGTACCGTACCCTGCTCTACGGCGGCATCTTTGCCTATCCCGCTGATAAAAAG
AGTCCCAAGGGCAAGCTGCGCATCTTGTACGAGTGTGCGCCCATGGCCATGGTTTTTGAAAATGCCGGCGGACAG
GCGCTCGACAGCAATATGCGACGGATGCTCGACGTGTGTCCCGAGCACATTCACGATCGCTCAGGCATTTTCATG
GGCAGTTGGGACGAAATGGAAAAAGTAAAGCAATTCCACAAGTAG
Transcript >OphauG2|586
ATGGATCAAAACGGCAACGGCGAAAAGGTTAATACACAAATCGTCACTCTGACGCGCTTTCTCAACGAGGAGCAG
ACCAAGCACAGGGATGCGTCGGGTGATTTCACCCTCCTCTGCCATGCCCTTCAATTCTCTTTCAAGTCGATTGCC
TATTACATTCGCCGCGCCACCTTGGTCAACTTGACGGGCTTGGCCGGCTCGTCAAACAGTACTGGCGACGACCAG
AAGAAACTCGACGTCATCTCCAACGACCTCTTTATCGAGGCCATGCGTTCCTCAGGAAAGTGTGCGCTGCTTGTT
TCAGAGGAGGAGGACCAGGTCATCTTCTTCCCCGAGGCGCATGGCGCGCGCTACGCTGTGGCATGTGATCCCATT
GACGGATCGTCCAATCTCGATGCTGGCGTTTCTGTAGGGACTATCTTTGCCGTGCACAAGCTGCCCGAAGGGTCG
ACTGGCACCAAGGAAGATGTTCTCAAGCCCGGCACCGAGCTTGTCGCTGCTGGCTTCACCATGTATGGTGCGTCG
GCGCAGCTTGTGCTCACCATCAAGGGCAGCTCCGTCAATGGCTTTACCCTGGACAATGGAATCGGCGAGTTCATC
CTGACGCACCCTAAAATGCAGATGCCGCGCTCGCGCCATATTTACTCGGTCAATGAAGGCAACTCGCTCTACTGG
GAGAAGCCCACCATTGACTACTTTGAGTCGCTCAAGCAGGCTCAGGACGACGGCAAGCCTTATAGTTCCCGTTAT
ATTGGCAGCATGGTTGCGGATGCGTACCGTACCCTGCTCTACGGCGGCATCTTTGCCTATCCCGCTGATAAAAAG
AGTCCCAAGGGCAAGCTGCGCATCTTGTACGAGTGTGCGCCCATGGCCATGGTTTTTGAAAATGCCGGCGGACAG
GCGCTCGACAGCAATATGCGACGGATGCTCGACGTGTGTCCCGAGCACATTCACGATCGCTCAGGCATTTTCATG
GGCAGTTGGGACGAAATGGAAAAAGTAAAGCAATTCCACAAGTAG
Gene >OphauG2|586
ATGGATCAAAACGGCAACGGCGAAAAGGTTAATACACAAATCGTCACTCTGACGCGCTTTCTCAACGAGGAGCAG
ACCAAGCACAGGGATGCGTCGGGTGATTTCACGTAGGCAGCTCCAAGCCTCCATTGTACCCTTCCTCCAGACGCT
AACTCTGCCCAGCCTCCTCTGCCATGCCCTTCAATTCTCTTTCAAGTCGATTGCCTATTACATTCGCCGCGCCAC
CTTGGTCAACTTGACGGGCTTGGCCGGCTCGTCAAACAGTACTGGCGACGACCAGAAGAAACTCGACGTCATCTC
CAACGACCTCTTTATCGAGGCCATGCGTTCCTCAGGAAAGTGTGCGCTGCTTGTTTCAGAGGAGGAGGACCAGGT
CATCTTCTTCCCCGAGGCGCATGGCGCGCGCTACGCTGTGGCATGTGATCCCATTGACGGATCGTCCAATCTCGA
TGCTGGCGTTTCTGTAGGGACTATCTTTGCCGTGCACAAGCTGCCCGAAGGGTCGACTGGCACCAAGGAAGATGT
TCTCAAGCCCGGCACCGAGCTTGTCGCTGCTGGCTTCACCATGTATGGTGCGTCGGCGCAGCTTGTGCTCACCAT
CAAGGGCAGCTCCGTCAATGGCTTTACCCTGGACAATGGAATCGGCGAGTTCATCCTGACGCACCCTAAAATGCA
GATGCCGCGCTCGCGCCATATTTACTCGGTCAATGAAGGCAACTCGCTCTACTGGGAGAAGCCCACCATTGACTA
CTTTGAGTCGCTCAAGCAGGCTCAGGACGACGGCAAGCCTTATAGTTCCCGTTATATTGGCAGCATGGTTGCGGA
TGCGTACCGTACCCTGCTCTACGGCGGCATCTTTGCCTATCCCGCTGATAAAAAGAGTCCCAAGGGCAAGCTGCG
CATCTTGTACGAGTGTGCGCCCATGGCCATGGTTTTTGAAAATGGTAATACAATCTGGTGTCTTTTTTTTTTTTT
TTTTTTTTTTTTGGCTTCAAGCTGACGATTTCGAATAGCCGGCGGACAGGCGCTCGACAGCAATATGCGACGGAT
GCTCGACGTGTGTCCCGAGCACATTCACGATCGCTCAGGCATTTTCATGGGCAGTTGGGACGAAATGGAAAAAGT
AAAGCAATTCCACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail