Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5857
Gene name
LocationContig_565:4314..5521
Strand+
Gene length (bp)1207
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04199 Cyclase Putative cyclase 3.7E-18 96 265

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004061 arylformamidase activity Yes
GO:0019441 tryptophan catabolic process to kynurenine Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0006576 cellular biogenic amine metabolic process No
GO:0016787 hydrolase activity No
GO:0042430 indole-containing compound metabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0008152 metabolic process No
GO:0006568 tryptophan metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0046218 indolalkylamine catabolic process No
GO:0070189 kynurenine metabolic process No
GO:0044106 cellular amine metabolic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:0042180 cellular ketone metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009310 amine catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0044248 cellular catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0042402 cellular biogenic amine catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016054 organic acid catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0003824 catalytic activity No
GO:0006586 indolalkylamine metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009308 amine metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0042436 indole-containing compound catabolic process No
GO:0003674 molecular_function No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0042537 benzene-containing compound metabolic process No
GO:0009074 aromatic amino acid family catabolic process No
GO:0006569 tryptophan catabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:0044282 small molecule catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup290
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5857 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7819
Ophiocordyceps australis map64 (Brazil) OphauB2|259
Ophiocordyceps australis map64 (Brazil) OphauB2|6807
Ophiocordyceps australis map64 (Brazil) OphauB2|7407
Ophiocordyceps camponoti-floridani Ophcf2|03580
Ophiocordyceps camponoti-rufipedis Ophun1|6652
Ophiocordyceps kimflemingae Ophio5|5474
Ophiocordyceps subramaniannii Hirsu2|6524
Ophiocordyceps subramaniannii Hirsu2|876
Ophiocordyceps subramaniannii Hirsu2|9530

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5857
MAVDPSSVPNFDNLPRVQGMPPGCAWGIFDKGGKKDLVGTLNFLTPEIVKAAASEVKTGISVSLNWPLTAISKVK
PFKRAKPKHNILYLPETSNVSNKVKSWEDELEFNPQDSSQWDSLVHIHHYPTNMVYNGFSPDKQMLSVESTEENV
LPTLDHWHPRGGLVGRGVLIDYKKYAEEKGVPFEPCDGIAITVPDLESCIEYFGITIRPGDILLLRTGTTEALEN
PATHQPSYSQMSGLESSPEMARWLWDHRFAAVASDTFALEAINTLRADGAVDGMERMILHHYLLSMFGMPIGELF
DLKRLSEYANKLKQYTFLLTSVPLNHPGLVGSPANAVAIF*
Coding >OphauG2|5857
ATGGCTGTTGATCCCTCATCAGTTCCAAACTTTGATAACCTGCCCCGTGTTCAGGGCATGCCCCCCGGATGCGCT
TGGGGCATCTTTGACAAAGGTGGCAAGAAGGATTTGGTTGGAACACTCAACTTTCTCACTCCTGAAATTGTAAAA
GCTGCTGCCAGCGAAGTCAAGACGGGCATTTCCGTTTCTCTCAACTGGCCCCTCACCGCCATCAGCAAGGTCAAG
CCCTTTAAGCGCGCCAAGCCAAAGCACAACATCCTCTACCTGCCGGAAACGAGCAATGTGTCAAACAAGGTCAAG
TCATGGGAGGACGAGCTAGAGTTTAACCCCCAGGACAGCAGCCAGTGGGACAGCCTGGTGCACATCCACCACTAC
CCAACAAACATGGTGTACAATGGCTTCAGCCCAGACAAGCAGATGCTCAGCGTCGAGTCAACAGAGGAGAATGTG
CTGCCGACGCTGGACCACTGGCACCCTCGCGGCGGGCTGGTTGGGCGCGGCGTGCTGATTGACTACAAAAAGTAT
GCAGAGGAAAAGGGCGTGCCCTTTGAGCCCTGCGACGGCATCGCAATCACCGTGCCAGACCTGGAATCGTGCATC
GAGTACTTTGGCATCACCATCCGCCCGGGAGACATTCTTTTGCTTCGGACGGGCACCACTGAGGCGCTGGAGAAT
CCGGCAACGCACCAGCCGTCGTATAGCCAGATGAGCGGGCTGGAGAGCAGTCCCGAGATGGCGCGATGGCTCTGG
GACCACCGCTTCGCAGCCGTGGCGTCGGACACGTTTGCGCTGGAAGCCATTAATACGCTTCGGGCCGATGGAGCA
GTCGACGGCATGGAGCGGATGATCTTGCACCACTACCTCCTCAGCATGTTTGGCATGCCCATTGGCGAGCTCTTT
GACCTCAAGCGGCTGTCCGAGTATGCAAACAAGCTGAAGCAGTACACCTTTTTGCTCACGTCGGTGCCCCTCAAC
CACCCTGGCCTTGTTGGCTCGCCAGCCAATGCCGTGGCCATTTTCTAG
Transcript >OphauG2|5857
ATGGCTGTTGATCCCTCATCAGTTCCAAACTTTGATAACCTGCCCCGTGTTCAGGGCATGCCCCCCGGATGCGCT
TGGGGCATCTTTGACAAAGGTGGCAAGAAGGATTTGGTTGGAACACTCAACTTTCTCACTCCTGAAATTGTAAAA
GCTGCTGCCAGCGAAGTCAAGACGGGCATTTCCGTTTCTCTCAACTGGCCCCTCACCGCCATCAGCAAGGTCAAG
CCCTTTAAGCGCGCCAAGCCAAAGCACAACATCCTCTACCTGCCGGAAACGAGCAATGTGTCAAACAAGGTCAAG
TCATGGGAGGACGAGCTAGAGTTTAACCCCCAGGACAGCAGCCAGTGGGACAGCCTGGTGCACATCCACCACTAC
CCAACAAACATGGTGTACAATGGCTTCAGCCCAGACAAGCAGATGCTCAGCGTCGAGTCAACAGAGGAGAATGTG
CTGCCGACGCTGGACCACTGGCACCCTCGCGGCGGGCTGGTTGGGCGCGGCGTGCTGATTGACTACAAAAAGTAT
GCAGAGGAAAAGGGCGTGCCCTTTGAGCCCTGCGACGGCATCGCAATCACCGTGCCAGACCTGGAATCGTGCATC
GAGTACTTTGGCATCACCATCCGCCCGGGAGACATTCTTTTGCTTCGGACGGGCACCACTGAGGCGCTGGAGAAT
CCGGCAACGCACCAGCCGTCGTATAGCCAGATGAGCGGGCTGGAGAGCAGTCCCGAGATGGCGCGATGGCTCTGG
GACCACCGCTTCGCAGCCGTGGCGTCGGACACGTTTGCGCTGGAAGCCATTAATACGCTTCGGGCCGATGGAGCA
GTCGACGGCATGGAGCGGATGATCTTGCACCACTACCTCCTCAGCATGTTTGGCATGCCCATTGGCGAGCTCTTT
GACCTCAAGCGGCTGTCCGAGTATGCAAACAAGCTGAAGCAGTACACCTTTTTGCTCACGTCGGTGCCCCTCAAC
CACCCTGGCCTTGTTGGCTCGCCAGCCAATGCCGTGGCCATTTTCTAG
Gene >OphauG2|5857
ATGGCTGTTGATCCCTCATCAGTTCCAAACTTTGATAACCTGCCCCGTGTTCAGGGCATGCCCCCCGGATGCGCT
TGGGGCATCTTTGACAAAGGTGGCAAGAAGGATTTGGTTGGAACACTCAACTTTCTCACTCCTGAAATTGTAAAA
GCTGCTGCCAGCGAAGTCAAGACGGGCATTTCCGTTTCTCTCAAGTAAGAGCCCTTGTCACGCCTCTTTTTTTTT
TTTCCTTTTTTCCGAGTCTCTACTCACACGTCTTCCTCTAGCTGGCCCCTCACCGCCATCAGCAAGGTCAAGCCC
TTTAAGCGCGCCAAGCCAAAGCACAACATCCTCTACCTGCCGGAAACGAGCAATGTGTCAAACAAGGTCAAGTCA
TGGGAGGACGAGCTAGAGTTTAACCCCCAGGACAGCAGCCAGTGGGACAGCCTGGTGCACATCCACCACTACCCA
ACAAACATGGTGTACAATGGCTTCAGCCCAGACAAGCAGATGCTCAGCGTCGAGTCAACAGAGGAGAATGTGCTG
CCGACGCTGGACCACTGGCACCCTCGCGGCGGGCTGGTTGGGCGCGGCGTGCTGATTGACTACAAAAAGTATGCA
GAGGAAAAGGGCGTGCCCTTTGAGCCCTGCGACGGCATCGCAATCACCGTGCCAGACCTGGAATCGTGCATCGAG
TACTTTGGCATCACCATCCGCCCGGGAGACATTCTTTTGCTTCGGACGGGCACCACTGAGGCGCTGGAGAATCCG
GCAACGCACCAGCCGTCGTATAGCCAGATGAGCGGGCTGGAGAGCAGTCCCGAGATGGCGCGATGGCTCTGGGAC
CACCGCTTCGCAGCCGTGGCGTCGGACACGTTTGCGCTGGAAGCCATTAATACGCTTCGGGCCGATGGAGCAGTC
GACGGCATGGAGCGGATGAGTAGGTTTTTTTCTTTTTTTTTTAATCTGCGTGGTTTTTTTTATAAATCAGCGTGG
TTATTTTTTTCTTTAAAAAAAAAAAAAAAAACACTTGGCTAACGCCGGCTCTTCAGTCTTGCACCACTACCTCCT
CAGCATGTTTGGCATGCCCATTGGCGAGCTCTTTGACCTCAAGCGGCTGTCCGAGTATGCAAACAAGCTGAAGCA
GTACACCTTTTTGCTCACGTCGGTGCCCCTCAACCACCCTGGCCTTGTTGGCTCGCCAGCCAATGCCGTGGCCAT
TTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail