Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|584
Gene name
LocationContig_114:25111..26684
Strand+
Gene length (bp)1573
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-09 9 70
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-11 104 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78814|SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp2 PE=1 SV=2 4 171 1.0E-30
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 8 171 1.0E-26
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 8 171 2.0E-26
sp|Q23120|RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans GN=rsp-2 PE=3 SV=1 7 173 3.0E-24
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 8 171 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78814|SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp2 PE=1 SV=2 4 171 1.0E-30
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 8 171 1.0E-26
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 8 171 2.0E-26
sp|Q23120|RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans GN=rsp-2 PE=3 SV=1 7 173 3.0E-24
sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 8 171 1.0E-23
sp|Q09167|SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus GN=Srsf5 PE=1 SV=1 4 169 2.0E-23
sp|O35326|SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus GN=Srsf5 PE=1 SV=2 4 169 2.0E-23
sp|Q13243|SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens GN=SRSF5 PE=1 SV=1 4 169 2.0E-23
sp|G3V6S8|SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus GN=Srsf6 PE=1 SV=1 8 171 5.0E-23
sp|Q3TWW8|SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus GN=Srsf6 PE=1 SV=1 8 171 5.0E-23
sp|Q23121|RSP1_CAEEL Probable splicing factor, arginine/serine-rich 1 OS=Caenorhabditis elegans GN=rsp-1 PE=3 SV=1 6 173 1.0E-22
sp|Q5PPI1|SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus GN=Srsf9 PE=1 SV=1 8 164 3.0E-22
sp|Q3B7L6|SRSF6_BOVIN Serine/arginine-rich splicing factor 6 OS=Bos taurus GN=SRSF6 PE=2 SV=1 8 171 4.0E-22
sp|Q9D0B0|SRSF9_MOUSE Serine/arginine-rich splicing factor 9 OS=Mus musculus GN=Srsf9 PE=1 SV=1 8 164 8.0E-22
sp|Q9XFR5|SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana GN=SR30 PE=1 SV=1 9 163 2.0E-21
sp|P26686|SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster GN=B52 PE=1 SV=4 7 171 3.0E-21
sp|Q13242|SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens GN=SRSF9 PE=1 SV=1 8 164 1.0E-20
sp|O22315|SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana GN=SR34 PE=1 SV=1 1 163 5.0E-20
sp|Q5ZML3|SRSF1_CHICK Serine/arginine-rich splicing factor 1 OS=Gallus gallus GN=SRSF1 PE=1 SV=3 5 186 5.0E-20
sp|Q6NYA0|SRS1B_DANRE Serine/arginine-rich splicing factor 1B OS=Danio rerio GN=srsf1b PE=2 SV=1 5 164 1.0E-19
sp|Q5R7H2|SRSF1_PONAB Serine/arginine-rich splicing factor 1 OS=Pongo abelii GN=SRSF1 PE=2 SV=3 5 164 1.0E-19
sp|Q3YLA6|SRSF1_PIG Serine/arginine-rich splicing factor 1 OS=Sus scrofa GN=SRSF1 PE=2 SV=3 5 164 1.0E-19
sp|Q6PDM2|SRSF1_MOUSE Serine/arginine-rich splicing factor 1 OS=Mus musculus GN=Srsf1 PE=1 SV=3 5 164 1.0E-19
sp|Q07955|SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 5 164 1.0E-19
sp|Q0VCY7|SRSF1_BOVIN Serine/arginine-rich splicing factor 1 OS=Bos taurus GN=SRSF1 PE=2 SV=1 5 164 1.0E-19
sp|Q7SXP4|SRS1A_DANRE Serine/arginine-rich splicing factor 1A OS=Danio rerio GN=srsf1a PE=2 SV=2 5 164 2.0E-19
sp|Q6DII2|SRSF1_XENTR Serine/arginine-rich splicing factor 1 OS=Xenopus tropicalis GN=srsf1 PE=2 SV=1 5 164 3.0E-18
sp|Q01560|NOP3_YEAST Nucleolar protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPL3 PE=1 SV=1 3 174 5.0E-17
sp|A2RVS6|SR34A_ARATH Serine/arginine-rich splicing factor SR34A OS=Arabidopsis thaliana GN=SR34A PE=2 SV=1 6 163 8.0E-16
sp|F4JHI7|SR34B_ARATH Serine/arginine-rich splicing factor SR34B OS=Arabidopsis thaliana GN=SR34B PE=2 SV=1 1 163 4.0E-15
sp|Q9NEW6|RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans GN=rsp-3 PE=1 SV=2 8 164 5.0E-15
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 8 171 7.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 8 174 1.0E-08
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 6 168 5.0E-08
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 8 168 9.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 8 163 1.0E-07
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 8 163 4.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 2 221 5.0E-07
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 8 174 5.0E-07
sp|Q10021|RSP5_CAEEL Probable splicing factor, arginine/serine-rich 5 OS=Caenorhabditis elegans GN=rsp-5 PE=3 SV=3 8 77 7.0E-07
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 8 170 7.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 2 221 7.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 2 221 9.0E-07
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 2 160 1.0E-06
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 8 166 1.0E-06
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 8 168 2.0E-06
sp|O88477|IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus GN=Igf2bp1 PE=1 SV=1 8 168 2.0E-06
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 8 168 2.0E-06
sp|Q9FYB7|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana GN=RS2Z32 PE=1 SV=1 6 78 2.0E-06
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 9 167 3.0E-06
sp|Q94901|LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster GN=lark PE=1 SV=1 1 173 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|584
MTEVSSTRLYLGNLPRNATKADVEAHFATHGTGEITEVKLMNGFGFIEYKDPMDARDVVPDGSDFMGERLTVQFA
RGSRAREGGFGIHERAPPRPRRTPHRMQITGLPHDTSWQDLKDFARQSGMDVVFSETGRDSGRGFVEYETATDLR
NAVEKLDGREFKGHRVQCVADTQPDFPPRERGRSRSPGRRPHGPPFEQYDRRGPPRGVVGGYSPRRGEPGPYAYR
DRSPRREYYDDRARYRSPPRRPTDDYPPARGRYDDPYRRDYPPTAPEPYANGRAYDRPPRDFAPREPPYPPREGY
AREYERGGRYW*
Coding >OphauG2|584
ATGACCGAGGTCTCTTCTACCAGGCTCTATCTGGGCAATTTGCCGCGTAATGCTACCAAGGCAGACGTTGAGGCC
CATTTTGCGACCCATGGGACTGGTGAGATTACAGAGGTAAAGCTGATGAATGGCTTTGGCTTCATTGAGTATAAG
GACCCGATGGACGCCCGAGACGTTGTTCCTGATGGATCAGACTTCATGGGAGAACGCCTGACAGTCCAATTTGCA
CGTGGTTCTCGCGCTCGCGAGGGAGGCTTCGGCATCCATGAGCGCGCTCCTCCAAGACCTCGACGCACCCCGCAC
CGCATGCAGATCACGGGACTCCCTCACGATACCAGTTGGCAGGACCTTAAAGATTTTGCGCGCCAGTCCGGCATG
GACGTGGTATTCTCGGAGACAGGTCGTGACTCAGGCAGAGGATTTGTCGAATACGAAACGGCTACGGATCTGAGA
AACGCGGTCGAGAAGCTCGACGGCCGCGAGTTCAAGGGACACCGCGTTCAGTGCGTAGCTGATACTCAACCTGAC
TTTCCCCCGCGAGAACGCGGTCGCTCTCGCTCCCCCGGCCGTCGCCCCCATGGGCCCCCGTTTGAGCAGTACGAT
CGTCGTGGACCGCCGCGCGGCGTAGTTGGTGGTTACAGTCCTCGTCGAGGAGAACCGGGGCCGTATGCCTATCGC
GATCGGAGCCCTCGCCGTGAATACTACGATGACCGAGCACGGTACCGATCGCCTCCTCGACGCCCCACGGACGAC
TACCCGCCCGCGCGTGGCCGATACGACGATCCTTACCGTCGTGACTACCCTCCCACCGCCCCTGAGCCGTATGCT
AATGGACGGGCGTATGACCGTCCGCCTCGCGACTTTGCTCCACGTGAGCCACCCTATCCGCCGCGCGAAGGCTAT
GCTCGTGAATACGAACGAGGCGGGCGCTACTGGTAA
Transcript >OphauG2|584
ATGACCGAGGTCTCTTCTACCAGGCTCTATCTGGGCAATTTGCCGCGTAATGCTACCAAGGCAGACGTTGAGGCC
CATTTTGCGACCCATGGGACTGGTGAGATTACAGAGGTAAAGCTGATGAATGGCTTTGGCTTCATTGAGTATAAG
GACCCGATGGACGCCCGAGACGTTGTTCCTGATGGATCAGACTTCATGGGAGAACGCCTGACAGTCCAATTTGCA
CGTGGTTCTCGCGCTCGCGAGGGAGGCTTCGGCATCCATGAGCGCGCTCCTCCAAGACCTCGACGCACCCCGCAC
CGCATGCAGATCACGGGACTCCCTCACGATACCAGTTGGCAGGACCTTAAAGATTTTGCGCGCCAGTCCGGCATG
GACGTGGTATTCTCGGAGACAGGTCGTGACTCAGGCAGAGGATTTGTCGAATACGAAACGGCTACGGATCTGAGA
AACGCGGTCGAGAAGCTCGACGGCCGCGAGTTCAAGGGACACCGCGTTCAGTGCGTAGCTGATACTCAACCTGAC
TTTCCCCCGCGAGAACGCGGTCGCTCTCGCTCCCCCGGCCGTCGCCCCCATGGGCCCCCGTTTGAGCAGTACGAT
CGTCGTGGACCGCCGCGCGGCGTAGTTGGTGGTTACAGTCCTCGTCGAGGAGAACCGGGGCCGTATGCCTATCGC
GATCGGAGCCCTCGCCGTGAATACTACGATGACCGAGCACGGTACCGATCGCCTCCTCGACGCCCCACGGACGAC
TACCCGCCCGCGCGTGGCCGATACGACGATCCTTACCGTCGTGACTACCCTCCCACCGCCCCTGAGCCGTATGCT
AATGGACGGGCGTATGACCGTCCGCCTCGCGACTTTGCTCCACGTGAGCCACCCTATCCGCCGCGCGAAGGCTAT
GCTCGTGAATACGAACGAGGCGGGCGCTACTGGTAA
Gene >OphauG2|584
ATGACCGAGGTCTCTTCTACCAGGCTCTATCTGGGCAATTTGCCGCGTAATGGTTTGCACACTTTCAACACCCTA
TACCATGGAGTAATCAGCTATTCTGACAAACGCACAACAGCTACCAAGGCAGACGTTGAGGCCCATTTTGCGACC
CATGGGACTGGTGAGATTACAGAGGTAAAGCTGATGAATGGCTTTGGCTTCATTGAGTATAAGGACCCGATGGAC
GCCCGAGACGTTGTTCCTGGTATGTTCATGATGTAGACATCGCATGCCACGATTTCGAGGACAAATACTGACGCT
TCCGCACTGGCTCCTAGCTTTTCGTATGTAATTCTTCAATCTGCATTCTCCAACAAAATACTCTGGACTAATGTG
GCCGGTTCCAGATGGATCAGACTTCATGGGAGAACGCCTGACAGTCCAATTTGCACGTGGTTCTCGCGCTCGCGA
GGGAGGCTTCGGCATCCATGAGCGCGCTCCTCCAAGACCTCGACGCACCCCGCACCGCATGCAGATCACGGGACT
CCCTCACGATACCAGTTGGCAGGTCTGTCCCTTCTTCCCGTTTCTTATTTCCGGACTCCATGGACTTCCATTCAT
TCCACCTTTGATTCCCTTGCTCCGGACATGTCTGCCTTGGCCGGGATTAGCGCCCTGAAATCATGCTTTTCTTTA
ATCATCTCTATTGGACTGGATCCAACACGACCCTTCCCTTCTTCCTGCGATGGAGTACTGGCGAATCAGGCACGG
CATTCACTACGTTTCGGCATCTCGCCAGTGTCACATGACTCCTGGGAACAACAACTTACGTGGAATCTTGGGAAT
AGGACCTTAAAGATTTTGCGCGCCAGTCCGGCATGGACGTGGTATTCTCGGAGACAGGTCGTGACTCAGGCAGAG
GGTGAGTGCTTTCACTGTTCGACTTTGTCTTGCTTCAAGGTAGCTCTATATAATCTTGGGCTAACACAAAGTCAT
CTACCAGATTTGTCGAATACGAAACGGCTACGGATCTGAGAAACGCGGTCGAGAAGCTCGACGGCCGCGAGTTCA
AGGGACACCGCGTTCAGTGCGTAGCTGATGCAAGTACAACCCAACGAGTTCAAGTCCATGTCTGGAAAAAAAAAA
TGCGGTCTGACCAGTTTACGTACAGACTCAACCTGACTTTCCCCCGCGAGAACGCGGTCGCTCTCGCTCCCCCGG
CCGTCGCCCCCATGGGCCCCCGTTTGAGCAGTACGATCGTCGTGGACCGCCGCGCGGCGTAGTTGGTGGTTACAG
TCCTCGTCGAGGAGAACCGGGGCCGTATGCCTATCGCGATCGGAGCCCTCGCCGTGAATACTACGATGACCGAGC
ACGGTACCGATCGCCTCCTCGACGCCCCACGGACGACTACCCGCCCGCGCGTGGCCGATACGACGATCCTTACCG
TCGTGACTACCCTCCCACCGCCCCTGAGCCGTATGCTAATGGACGGGCGTATGACCGTCCGCCTCGCGACTTTGC
TCCACGTGAGCCACCCTATCCGCCGCGCGAAGGCTATGCTCGTGAATACGAACGAGGCGGGCGCTACTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail