Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5835
Gene name
LocationContig_560:11451..12489
Strand+
Gene length (bp)1038
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01048 PNP_UDP_1 Phosphorylase superfamily 2.1E-12 15 318

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009116 nucleoside metabolic process Yes
GO:1901135 carbohydrate derivative metabolic process No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5835
MARVVRPTSRNDFEIAIICALTLEANAVQALFEHCWDRDGPPFGKLVGDANAYSTGYLSRHHVVLAYLPGMGKVN
AAAATASFRISFPNIKLALVVGVCGVAPFMPGTRDEIILGDVIISNGIVQYDFGRQFPEVFVRKDTILDSLPRPN
MEISALSAKLRTLYGQQSLRDSMAHSLDRLRMISDLRATYPGVEQDQLYESSYRHLGDGMTCQXXXXXXCGCSGA
LVPRRRLAQGMPQPAVHFGLIASGDKLLRAGLERDDLVRRENVIGFEMEGAGVCSSIPCVVIKGACDYADSHKAK
TWQNYAAATAAACAKAFLDQWVPLAIHGAWGILHEVCLDGVADLV*
Coding >OphauG2|5835
ATGGCTCGAGTCGTGCGTCCGACTAGTCGCAACGACTTTGAAATTGCCATCATCTGTGCCCTCACCCTCGAGGCC
AACGCCGTCCAGGCTCTCTTTGAGCACTGCTGGGACCGCGACGGACCCCCCTTTGGGAAACTTGTTGGAGATGCA
AACGCCTACTCTACCGGCTACTTGAGCCGCCATCATGTTGTGCTTGCCTATCTGCCTGGTATGGGCAAGGTCAAT
GCGGCGGCTGCCACGGCCAGCTTCCGCATCAGCTTCCCCAATATCAAGCTGGCGCTCGTGGTTGGTGTTTGCGGC
GTGGCGCCTTTTATGCCTGGGACTCGGGACGAGATTATACTCGGCGACGTCATCATTAGCAACGGCATTGTCCAG
TACGACTTTGGACGACAGTTCCCTGAAGTCTTTGTCCGCAAAGATACCATTCTAGATTCGTTGCCCAGACCGAAT
ATGGAGATTAGCGCGCTGTCGGCCAAGCTGAGAACGCTGTACGGGCAGCAATCGCTGAGAGACAGCATGGCCCAT
AGTCTAGACAGGCTGAGAATGATTTCGGATCTGAGAGCCACCTATCCAGGAGTAGAGCAAGACCAGCTCTACGAG
TCTAGTTATCGTCACCTTGGCGATGGCATGACGTGTCAGGNNNNNNNNNNNNNNNNGTGTGGATGTAGTGGTGCC
TTGGTGCCGCGTCGCCGTCTTGCTCAGGGCATGCCTCAGCCTGCCGTGCACTTTGGCTTGATAGCATCTGGGGAC
AAGCTTCTAAGGGCTGGACTGGAGCGAGATGACCTGGTAAGACGAGAAAATGTCATTGGTTTCGAGATGGAGGGC
GCTGGAGTATGCAGCAGCATTCCATGCGTGGTCATCAAGGGCGCCTGTGACTACGCAGATAGCCACAAGGCCAAG
ACGTGGCAAAACTATGCTGCTGCAACGGCCGCCGCCTGTGCCAAGGCGTTTTTGGACCAATGGGTGCCTTTGGCT
ATCCATGGTGCGTGGGGGATTTTGCATGAGGTTTGTTTGGATGGAGTTGCTGACTTGGTCTAA
Transcript >OphauG2|5835
ATGGCTCGAGTCGTGCGTCCGACTAGTCGCAACGACTTTGAAATTGCCATCATCTGTGCCCTCACCCTCGAGGCC
AACGCCGTCCAGGCTCTCTTTGAGCACTGCTGGGACCGCGACGGACCCCCCTTTGGGAAACTTGTTGGAGATGCA
AACGCCTACTCTACCGGCTACTTGAGCCGCCATCATGTTGTGCTTGCCTATCTGCCTGGTATGGGCAAGGTCAAT
GCGGCGGCTGCCACGGCCAGCTTCCGCATCAGCTTCCCCAATATCAAGCTGGCGCTCGTGGTTGGTGTTTGCGGC
GTGGCGCCTTTTATGCCTGGGACTCGGGACGAGATTATACTCGGCGACGTCATCATTAGCAACGGCATTGTCCAG
TACGACTTTGGACGACAGTTCCCTGAAGTCTTTGTCCGCAAAGATACCATTCTAGATTCGTTGCCCAGACCGAAT
ATGGAGATTAGCGCGCTGTCGGCCAAGCTGAGAACGCTGTACGGGCAGCAATCGCTGAGAGACAGCATGGCCCAT
AGTCTAGACAGGCTGAGAATGATTTCGGATCTGAGAGCCACCTATCCAGGAGTAGAGCAAGACCAGCTCTACGAG
TCTAGTTATCGTCACCTTGGCGATGGCATGACGTGTCAGGNNNNNNNNNNNNNNNNGTGTGGATGTAGTGGTGCC
TTGGTGCCGCGTCGCCGTCTTGCTCAGGGCATGCCTCAGCCTGCCGTGCACTTTGGCTTGATAGCATCTGGGGAC
AAGCTTCTAAGGGCTGGACTGGAGCGAGATGACCTGGTAAGACGAGAAAATGTCATTGGTTTCGAGATGGAGGGC
GCTGGAGTATGCAGCAGCATTCCATGCGTGGTCATCAAGGGCGCCTGTGACTACGCAGATAGCCACAAGGCCAAG
ACGTGGCAAAACTATGCTGCTGCAACGGCCGCCGCCTGTGCCAAGGCGTTTTTGGACCAATGGGTGCCTTTGGCT
ATCCATGGTGCGTGGGGGATTTTGCATGAGGTTTGTTTGGATGGAGTTGCTGACTTGGTCTAA
Gene >OphauG2|5835
ATGGCTCGAGTCGTGCGTCCGACTAGTCGCAACGACTTTGAAATTGCCATCATCTGTGCCCTCACCCTCGAGGCC
AACGCCGTCCAGGCTCTCTTTGAGCACTGCTGGGACCGCGACGGACCCCCCTTTGGGAAACTTGTTGGAGATGCA
AACGCCTACTCTACCGGCTACTTGAGCCGCCATCATGTTGTGCTTGCCTATCTGCCTGGTATGGGCAAGGTCAAT
GCGGCGGCTGCCACGGCCAGCTTCCGCATCAGCTTCCCCAATATCAAGCTGGCGCTCGTGGTTGGTGTTTGCGGC
GTGGCGCCTTTTATGCCTGGGACTCGGGACGAGATTATACTCGGCGACGTCATCATTAGCAACGGCATTGTCCAG
TACGACTTTGGACGACAGTTCCCTGAAGTCTTTGTCCGCAAAGATACCATTCTAGATTCGTTGCCCAGACCGAAT
ATGGAGATTAGCGCGCTGTCGGCCAAGCTGAGAACGCTGTACGGGCAGCAATCGCTGAGAGACAGCATGGCCCAT
AGTCTAGACAGGCTGAGAATGATTTCGGATCTGAGAGCCACCTATCCAGGAGTAGAGCAAGACCAGCTCTACGAG
TCTAGTTATCGTCACCTTGGCGATGGCATGACGTGTCAGGNNNNNNNNNNNNNNNNGTGTGGATGTAGTGGTGCC
TTGGTGCCGCGTCGCCGTCTTGCTCAGGGCATGCCTCAGCCTGCCGTGCACTTTGGCTTGATAGCATCTGGGGAC
AAGCTTCTAAGGGCTGGACTGGAGCGAGATGACCTGGTAAGACGAGAAAATGTCATTGGTTTCGAGATGGAGGGC
GCTGGAGTATGCAGCAGCATTCCATGCGTGGTCATCAAGGGCGCCTGTGACTACGCAGATAGCCACAAGGCCAAG
ACGTGGCAAAACTATGCTGCTGCAACGGCCGCCGCCTGTGCCAAGGCGTTTTTGGACCAATGGGTGCCTTTGGCT
ATCCATGGTGCGTGGGGGATTTTGCATGAGGTTTGTTTGGATGGAGTTGCTGACTTGGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail