Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5834
Gene name
LocationContig_560:9155..10469
Strand+
Gene length (bp)1314
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-21 95 231
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.3E-15 62 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 63 231 3.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 253 401 9.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 401 1.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 391 7.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 381 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 63 231 3.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 253 401 9.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 401 1.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 391 7.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 381 8.0E-14
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 63 240 8.0E-14
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 67 238 1.0E-13
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 56 238 7.0E-13
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 71 238 2.0E-12
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 63 240 2.0E-12
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 43 238 3.0E-12
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 62 238 6.0E-12
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 63 234 1.0E-11
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 64 238 2.0E-11
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 64 238 5.0E-11
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 56 238 8.0E-11
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 56 237 9.0E-11
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 63 234 3.0E-10
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 63 237 5.0E-10
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 49 234 7.0E-10
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 63 231 1.0E-09
sp|C0IPP2|NPIIB_TRIRU Probable neutral protease 2 homolog B OS=Trichophyton rubrum GN=NpII-B PE=3 SV=1 62 238 2.0E-09
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 54 238 2.0E-09
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 71 238 2.0E-08
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 64 238 2.0E-08
sp|O77788|NFM_BOVIN Neurofilament medium polypeptide OS=Bos taurus GN=NEFM PE=1 SV=3 277 353 3.0E-08
sp|O77788|NFM_BOVIN Neurofilament medium polypeptide OS=Bos taurus GN=NEFM PE=1 SV=3 275 356 3.0E-08
sp|Q3URU2|PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus GN=Peg3 PE=1 SV=1 268 356 4.0E-08
sp|A6SBW7|NPIIA_BOTFB Neutral protease 2 homolog SNOG_10522 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_10098 PE=3 SV=1 56 238 4.0E-08
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 67 238 1.0E-07
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 63 238 1.0E-07
sp|A7F811|NPIIA_SCLS1 Neutral protease 2 homolog SS1G_13741 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13741 PE=3 SV=1 59 238 1.0E-07
sp|C1G1N6|NPIIA_PARBD Neutral protease 2 homolog PADG_00776 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00776 PE=3 SV=1 70 238 2.0E-07
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 231 2.0E-07
sp|Q2UP30|NPIIA_ASPOR Neutral protease 2 homolog AO090001000135 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090001000135 PE=3 SV=1 63 238 2.0E-07
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 67 231 2.0E-07
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 67 231 2.0E-07
sp|C0S3U8|NPIIA_PARBP Neutral protease 2 homolog PABG_02362 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02362 PE=3 SV=2 70 238 2.0E-07
sp|B0Y4X9|NPIIB_ASPFC Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_070680 PE=3 SV=1 64 231 7.0E-07
sp|C5FCA7|NPIIB_ARTOC Probable neutral protease 2 homolog MCYG_00239 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00239 PE=3 SV=1 63 238 8.0E-07
sp|Q4WQR6|NPIIA_ASPFU Neutral protease 2 homolog AFUA_4G13750 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13750 PE=3 SV=1 64 231 8.0E-07
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 340 1.0E-06
sp|D4ANL2|NPIIB_ARTBC Probable neutral protease 2 homolog ARB_05817 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05817 PE=3 SV=1 63 231 2.0E-06
sp|D4DE03|NPIIB_TRIVH Probable neutral protease 2 homolog TRV_05367 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05367 PE=3 SV=1 63 231 2.0E-06
sp|C5PE62|MEP2_COCP7 Neutral protease 2 homolog MEP2 OS=Coccidioides posadasii (strain C735) GN=MEP2 PE=3 SV=1 62 231 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5834
MKTIAALGTVILTAAAAPSVFKRAYVSTLGSELPDDFVVQNLHPPASYFEGNDTALEQASPSKRATVDRSCNGQR
QQMINSALSGCASRAQKAAAAAKDPSNKLVLEFFKNDDQQTRQRVASVLEGVAADCGGGGKSTSIGCEQGESDQG
FYGFTRFGQGRPTMQLFPLFFSLGQQGGSCGHLDSTGMILHEMTHADAETDDFSSSYGLQAIAALAPQQNIQHAD
TYAFFSQAVDIGCSGSDLRRGGPPSGAPAQGSPNRNRSGNSPDDETDGQTGSPTGNSPNGNSPNGNSPVGNSPTG
NSPTGDSPFGNSPNGDSPFGDSPFGNPGNGNPQNGNSPFRNSPNGNSPNGDSPFDNSGNSGNGNSPFGNSPFENS
PFGNSPFDNSGNQNPQGGNSPFSASPFDASEIQSEQNSQDNSPSSLPNWVNEIVSYVTRSTE*
Coding >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG
Transcript >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG
Gene >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail