Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5834
Gene name
LocationContig_560:9155..10469
Strand+
Gene length (bp)1314
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-21 95 231
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.3E-15 62 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 63 231 3.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 253 401 9.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 401 1.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 391 7.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 381 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 63 231 3.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 253 401 9.0E-15
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 401 1.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 391 7.0E-14
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 381 8.0E-14
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 63 240 8.0E-14
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 67 238 1.0E-13
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 56 238 7.0E-13
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 71 238 2.0E-12
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 63 240 2.0E-12
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 43 238 3.0E-12
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 62 238 6.0E-12
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 63 234 1.0E-11
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 64 238 2.0E-11
sp|P46076|NPII_ASPOR Neutral protease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090010000493 PE=1 SV=2 64 238 5.0E-11
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 56 238 8.0E-11
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 56 237 9.0E-11
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 63 234 3.0E-10
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 63 237 5.0E-10
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 49 234 7.0E-10
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 63 231 1.0E-09
sp|C0IPP2|NPIIB_TRIRU Probable neutral protease 2 homolog B OS=Trichophyton rubrum GN=NpII-B PE=3 SV=1 62 238 2.0E-09
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 54 238 2.0E-09
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 71 238 2.0E-08
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 64 238 2.0E-08
sp|O77788|NFM_BOVIN Neurofilament medium polypeptide OS=Bos taurus GN=NEFM PE=1 SV=3 277 353 3.0E-08
sp|O77788|NFM_BOVIN Neurofilament medium polypeptide OS=Bos taurus GN=NEFM PE=1 SV=3 275 356 3.0E-08
sp|Q3URU2|PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus GN=Peg3 PE=1 SV=1 268 356 4.0E-08
sp|A6SBW7|NPIIA_BOTFB Neutral protease 2 homolog SNOG_10522 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_10098 PE=3 SV=1 56 238 4.0E-08
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 67 238 1.0E-07
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 63 238 1.0E-07
sp|A7F811|NPIIA_SCLS1 Neutral protease 2 homolog SS1G_13741 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13741 PE=3 SV=1 59 238 1.0E-07
sp|C1G1N6|NPIIA_PARBD Neutral protease 2 homolog PADG_00776 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00776 PE=3 SV=1 70 238 2.0E-07
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 49 231 2.0E-07
sp|Q2UP30|NPIIA_ASPOR Neutral protease 2 homolog AO090001000135 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090001000135 PE=3 SV=1 63 238 2.0E-07
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 67 231 2.0E-07
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 67 231 2.0E-07
sp|C0S3U8|NPIIA_PARBP Neutral protease 2 homolog PABG_02362 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02362 PE=3 SV=2 70 238 2.0E-07
sp|B0Y4X9|NPIIB_ASPFC Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_070680 PE=3 SV=1 64 231 7.0E-07
sp|C5FCA7|NPIIB_ARTOC Probable neutral protease 2 homolog MCYG_00239 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00239 PE=3 SV=1 63 238 8.0E-07
sp|Q4WQR6|NPIIA_ASPFU Neutral protease 2 homolog AFUA_4G13750 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13750 PE=3 SV=1 64 231 8.0E-07
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 277 340 1.0E-06
sp|D4ANL2|NPIIB_ARTBC Probable neutral protease 2 homolog ARB_05817 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05817 PE=3 SV=1 63 231 2.0E-06
sp|D4DE03|NPIIB_TRIVH Probable neutral protease 2 homolog TRV_05367 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05367 PE=3 SV=1 63 231 2.0E-06
sp|C5PE62|MEP2_COCP7 Neutral protease 2 homolog MEP2 OS=Coccidioides posadasii (strain C735) GN=MEP2 PE=3 SV=1 62 231 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.998849

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1025
Ophiocordyceps australis 1348a (Ghana) OphauG2|5834 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|6932
Ophiocordyceps australis map64 (Brazil) OphauB2|1528
Ophiocordyceps australis map64 (Brazil) OphauB2|158
Ophiocordyceps australis map64 (Brazil) OphauB2|408
Ophiocordyceps australis map64 (Brazil) OphauB2|4117
Ophiocordyceps subramaniannii Hirsu2|2978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5834
MKTIAALGTVILTAAAAPSVFKRAYVSTLGSELPDDFVVQNLHPPASYFEGNDTALEQASPSKRATVDRSCNGQR
QQMINSALSGCASRAQKAAAAAKDPSNKLVLEFFKNDDQQTRQRVASVLEGVAADCGGGGKSTSIGCEQGESDQG
FYGFTRFGQGRPTMQLFPLFFSLGQQGGSCGHLDSTGMILHEMTHADAETDDFSSSYGLQAIAALAPQQNIQHAD
TYAFFSQAVDIGCSGSDLRRGGPPSGAPAQGSPNRNRSGNSPDDETDGQTGSPTGNSPNGNSPNGNSPVGNSPTG
NSPTGDSPFGNSPNGDSPFGDSPFGNPGNGNPQNGNSPFRNSPNGNSPNGDSPFDNSGNSGNGNSPFGNSPFENS
PFGNSPFDNSGNQNPQGGNSPFSASPFDASEIQSEQNSQDNSPSSLPNWVNEIVSYVTRSTE*
Coding >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG
Transcript >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG
Gene >OphauG2|5834
ATGAAGACTATTGCAGCTCTGGGCACCGTCATCTTGACGGCTGCTGCCGCTCCCTCGGTTTTCAAGCGCGCATAT
GTGTCGACGCTGGGCAGTGAGCTTCCCGATGACTTTGTCGTGCAAAACTTGCATCCTCCGGCAAGCTACTTTGAA
GGCAACGATACCGCCTTGGAGCAGGCTTCGCCGTCCAAGCGAGCCACTGTCGACAGGAGCTGCAATGGCCAACGC
CAGCAAATGATCAACAGTGCCCTGTCTGGCTGCGCCTCGCGGGCCCAAAAGGCAGCAGCCGCAGCCAAGGACCCT
TCCAACAAGCTCGTGCTCGAGTTTTTCAAAAACGACGACCAGCAGACTCGCCAAAGAGTGGCCAGTGTTCTTGAA
GGCGTGGCTGCCGACTGCGGAGGCGGCGGCAAGAGCACGTCGATTGGGTGTGAGCAGGGAGAAAGCGACCAGGGA
TTCTACGGCTTCACGAGATTTGGCCAGGGCCGGCCGACAATGCAGCTGTTCCCCCTATTTTTCAGTCTCGGCCAG
CAAGGAGGCAGCTGTGGCCATCTGGATTCTACTGGCATGATTCTGCATGAGATGACGCACGCTGATGCTGAGACG
GACGATTTCAGTTCTTCGTATGGTCTTCAAGCTATTGCGGCGCTCGCACCGCAGCAGAATATCCAACATGCCGAT
ACCTATGCCTTTTTCTCGCAGGCGGTTGATATTGGATGCTCGGGCAGTGACTTGAGGAGAGGAGGGCCGCCTTCT
GGAGCGCCTGCTCAAGGCTCGCCGAACCGAAACAGGAGTGGAAATTCGCCTGATGATGAGACTGATGGACAGACG
GGATCGCCTACTGGAAACTCGCCTAACGGAAACTCGCCTAACGGAAACTCGCCTGTTGGTAACTCTCCTACTGGT
AACTCTCCTACTGGTGACTCTCCTTTTGGCAACTCGCCTAATGGTGACTCTCCTTTTGGCGACTCGCCCTTTGGA
AATCCGGGCAATGGAAACCCACAAAATGGAAACTCGCCATTTAGAAACTCGCCCAATGGAAACTCGCCCAATGGA
GACTCGCCGTTTGACAACTCGGGCAACTCGGGCAATGGAAACTCGCCATTTGGAAACTCTCCCTTTGAAAACTCT
CCCTTTGGAAACTCGCCGTTTGACAACTCGGGCAATCAAAACCCCCAAGGTGGAAACTCGCCCTTTTCTGCATCG
CCCTTTGACGCGTCAGAAATCCAATCCGAGCAAAACTCCCAGGACAACTCACCTTCTTCTCTCCCCAACTGGGTC
AACGAGATTGTCTCGTACGTGACGCGCAGCACCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail