Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5831
Gene name
LocationContig_56:38315..39341
Strand+
Gene length (bp)1026
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12353 eIF3g Eukaryotic translation initiation factor 3 subunit G 5.1E-44 29 155
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.9E-15 218 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MFP4|EIF3G_NEUCR Eukaryotic translation initiation factor 3 subunit G OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3g PE=3 SV=2 5 296 7.0E-145
sp|A6SGN8|EIF3G_BOTFB Eukaryotic translation initiation factor 3 subunit G OS=Botryotinia fuckeliana (strain B05.10) GN=tif35 PE=3 SV=1 12 296 1.0E-142
sp|A7EWN6|EIF3G_SCLS1 Eukaryotic translation initiation factor 3 subunit G OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif35 PE=3 SV=1 12 294 5.0E-142
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 30 294 1.0E-132
sp|A4RHN3|EIF3G_MAGO7 Eukaryotic translation initiation factor 3 subunit G OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF35 PE=3 SV=1 4 294 3.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MFP4|EIF3G_NEUCR Eukaryotic translation initiation factor 3 subunit G OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3g PE=3 SV=2 5 296 7.0E-145
sp|A6SGN8|EIF3G_BOTFB Eukaryotic translation initiation factor 3 subunit G OS=Botryotinia fuckeliana (strain B05.10) GN=tif35 PE=3 SV=1 12 296 1.0E-142
sp|A7EWN6|EIF3G_SCLS1 Eukaryotic translation initiation factor 3 subunit G OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif35 PE=3 SV=1 12 294 5.0E-142
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 30 294 1.0E-132
sp|A4RHN3|EIF3G_MAGO7 Eukaryotic translation initiation factor 3 subunit G OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF35 PE=3 SV=1 4 294 3.0E-129
sp|Q4X1I3|EIF3G_ASPFU Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif35 PE=3 SV=1 12 294 1.0E-124
sp|B0XS28|EIF3G_ASPFC Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tif35 PE=3 SV=1 12 294 1.0E-124
sp|Q0CPF9|EIF3G_ASPTN Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif35 PE=3 SV=1 7 296 6.0E-124
sp|Q2U002|EIF3G_ASPOR Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif35 PE=3 SV=1 7 295 3.0E-123
sp|A1DGS2|EIF3G_NEOFI Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=TIF35 PE=3 SV=1 12 294 7.0E-123
sp|A2R7Z2|EIF3G_ASPNC Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif35 PE=3 SV=1 7 294 9.0E-123
sp|Q1DPD9|EIF3G_COCIM Eukaryotic translation initiation factor 3 subunit G OS=Coccidioides immitis (strain RS) GN=TIF35 PE=3 SV=2 12 295 1.0E-119
sp|A1C646|EIF3G_ASPCL Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif35 PE=3 SV=1 7 294 8.0E-118
sp|C8V330|EIF3G_EMENI Eukaryotic translation initiation factor 3 subunit G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif35 PE=3 SV=1 10 294 4.0E-117
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 12 294 7.0E-101
sp|P78795|EIF3G_SCHPO Eukaryotic translation initiation factor 3 subunit G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif35 PE=1 SV=2 12 293 9.0E-75
sp|Q4P7G1|EIF3G_USTMA Eukaryotic translation initiation factor 3 subunit G OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF35 PE=3 SV=1 12 292 2.0E-72
sp|Q6DRC4|EIF3G_DANRE Eukaryotic translation initiation factor 3 subunit G OS=Danio rerio GN=eif3g PE=1 SV=1 10 293 2.0E-60
sp|A5E1Z4|EIF3G_LODEL Eukaryotic translation initiation factor 3 subunit G OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF35 PE=3 SV=1 13 294 2.0E-59
sp|Q28CY2|EIF3G_XENTR Eukaryotic translation initiation factor 3 subunit G OS=Xenopus tropicalis GN=eif3g PE=2 SV=1 29 293 3.0E-59
sp|Q641B2|EI3GB_XENLA Eukaryotic translation initiation factor 3 subunit G-B OS=Xenopus laevis GN=eif3g-b PE=2 SV=1 10 293 3.0E-58
sp|Q59ZV5|EIF3G_CANAL Eukaryotic translation initiation factor 3 subunit G OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF35 PE=3 SV=1 28 294 3.0E-58
sp|Q6DJI8|EI3GA_XENLA Eukaryotic translation initiation factor 3 subunit G-A OS=Xenopus laevis GN=eif3g-a PE=2 SV=1 39 293 2.0E-57
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 13 294 7.0E-56
sp|A3GGU2|EIF3G_PICST Eukaryotic translation initiation factor 3 subunit G OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF35 PE=3 SV=2 13 294 4.0E-54
sp|A7SKE9|EIF3G_NEMVE Eukaryotic translation initiation factor 3 subunit G OS=Nematostella vectensis GN=v1g171563 PE=3 SV=1 10 297 1.0E-53
sp|B0VZS1|EIF3G_CULQU Eukaryotic translation initiation factor 3 subunit G OS=Culex quinquefasciatus GN=eIF3-S4 PE=3 SV=1 5 293 2.0E-53
sp|A5DNX9|EIF3G_PICGU Eukaryotic translation initiation factor 3 subunit G OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF35 PE=3 SV=1 1 294 3.0E-53
sp|Q3ZC12|EIF3G_BOVIN Eukaryotic translation initiation factor 3 subunit G OS=Bos taurus GN=EIF3G PE=2 SV=1 39 293 5.0E-53
sp|Q9Z1D1|EIF3G_MOUSE Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus GN=Eif3g PE=1 SV=2 39 293 1.0E-52
sp|Q5RK09|EIF3G_RAT Eukaryotic translation initiation factor 3 subunit G OS=Rattus norvegicus GN=Eif3g PE=1 SV=1 39 293 1.0E-52
sp|O75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens GN=EIF3G PE=1 SV=2 39 293 2.0E-52
sp|Q1HQN4|EIF3G_AEDAE Eukaryotic translation initiation factor 3 subunit G OS=Aedes aegypti GN=eIF3-S4-1 PE=2 SV=1 5 293 9.0E-52
sp|Q7QJV0|EIF3G_ANOGA Eukaryotic translation initiation factor 3 subunit G OS=Anopheles gambiae GN=eIF3-S4 PE=3 SV=3 10 293 5.0E-51
sp|Q6CWX1|EIF3G_KLULA Eukaryotic translation initiation factor 3 subunit G OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF35 PE=3 SV=1 26 293 1.0E-50
sp|Q6BT10|EIF3G_DEBHA Eukaryotic translation initiation factor 3 subunit G OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF35 PE=3 SV=1 13 294 7.0E-50
sp|B4Q0Y7|EI3G1_DROYA Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila yakuba GN=eIF3-S4-1 PE=3 SV=1 10 293 3.0E-48
sp|B3P935|EI3G1_DROER Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila erecta GN=eIF3-S4-1 PE=3 SV=1 10 293 3.0E-48
sp|B4J4G8|EI3G1_DROGR Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila grimshawi GN=eIF3-S4-1 PE=3 SV=1 10 293 5.0E-48
sp|Q9W4X7|EI3G1_DROME Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila melanogaster GN=eIF3-S4-1 PE=1 SV=1 10 293 7.0E-48
sp|B4NTY9|EI3G1_DROSI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila simulans GN=eIF3-S4-1 PE=3 SV=1 10 293 7.0E-48
sp|B4I9X1|EI3G1_DROSE Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila sechellia GN=eIF3-S4-1 PE=3 SV=1 10 293 7.0E-48
sp|B3MYX2|EI3G1_DROAN Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila ananassae GN=eIF3-S4-1 PE=3 SV=1 10 293 1.0E-47
sp|B4N1L0|EI3G1_DROWI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila willistoni GN=eIF3-S4-1 PE=3 SV=1 10 293 1.0E-47
sp|B4L710|EI3G1_DROMO Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila mojavensis GN=eIF3-S4-1 PE=3 SV=1 10 293 2.0E-47
sp|B4MA85|EI3G1_DROVI Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila virilis GN=eIF3-S4-1 PE=3 SV=1 10 293 2.0E-47
sp|Q29GU0|EI3G1_DROPS Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S4-1 PE=3 SV=1 10 293 2.0E-47
sp|B4GUY6|EI3G1_DROPE Eukaryotic translation initiation factor 3 subunit G-1 OS=Drosophila persimilis GN=eIF3-S4-1 PE=3 SV=1 10 293 2.0E-47
sp|A6ZZ25|EIF3G_YEAS7 Eukaryotic translation initiation factor 3 subunit G OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF35 PE=3 SV=1 24 293 7.0E-47
sp|Q04067|EIF3G_YEAST Eukaryotic translation initiation factor 3 subunit G OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF35 PE=1 SV=1 24 293 7.0E-47
sp|A7TFW4|EIF3G_VANPO Eukaryotic translation initiation factor 3 subunit G OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF35 PE=3 SV=1 30 293 3.0E-46
sp|Q1HE00|EIF3G_BOMMO Eukaryotic translation initiation factor 3 subunit G OS=Bombyx mori GN=eIF3-S4 PE=2 SV=1 13 293 9.0E-46
sp|B4JXU2|EI3G2_DROGR Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila grimshawi GN=eIF3-S4-2 PE=3 SV=1 13 293 4.0E-44
sp|Q6FRZ6|EIF3G_CANGA Eukaryotic translation initiation factor 3 subunit G OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF35 PE=3 SV=1 29 293 1.0E-43
sp|B4NFY1|EI3G2_DROWI Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila willistoni GN=eIF3-S4-2 PE=3 SV=1 7 297 1.0E-43
sp|B4K7S5|EI3G2_DROMO Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila mojavensis GN=eIF3-S4-2 PE=3 SV=1 13 293 4.0E-43
sp|P0CN52|EIF3G_CRYNJ Eukaryotic translation initiation factor 3 subunit G OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF35 PE=3 SV=1 25 293 4.0E-43
sp|P0CN53|EIF3G_CRYNB Eukaryotic translation initiation factor 3 subunit G OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF35 PE=3 SV=1 25 293 4.0E-43
sp|B4LVR8|EI3G2_DROVI Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila virilis GN=eIF3-S4-2 PE=3 SV=1 13 293 4.0E-43
sp|B4G3E2|EI3G2_DROPE Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila persimilis GN=eIF3-S4-2 PE=3 SV=1 7 293 1.0E-42
sp|Q298C0|EI3G2_DROPS Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S4-2 PE=3 SV=1 7 293 5.0E-42
sp|B4IIC7|EI3G2_DROSE Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila sechellia GN=eIF3-S4-2 PE=3 SV=1 13 293 3.0E-41
sp|B3NYY7|EI3G2_DROER Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila erecta GN=eIF3-S4-2 PE=3 SV=1 13 293 7.0E-41
sp|B4QS37|EI3G2_DROSI Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila simulans GN=eIF3-S4-2 PE=3 SV=1 13 293 1.0E-40
sp|Q759T4|EIF3G_ASHGO Eukaryotic translation initiation factor 3 subunit G OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF35 PE=3 SV=1 24 293 1.0E-40
sp|B4PP90|EI3G2_DROYA Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila yakuba GN=eIF3-S4-2 PE=3 SV=1 13 293 1.0E-40
sp|Q9VDM6|EI3G2_DROME Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila melanogaster GN=eIF3-S4-2 PE=3 SV=1 13 293 2.0E-40
sp|B3MSP2|EI3G2_DROAN Eukaryotic translation initiation factor 3 subunit G-2 OS=Drosophila ananassae GN=eIF3-S4-2 PE=3 SV=1 7 293 3.0E-39
sp|A8NS61|EIF3G_BRUMA Eukaryotic translation initiation factor 3 subunit G OS=Brugia malayi GN=Bm1_08615 PE=3 SV=1 33 293 1.0E-35
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 58 293 3.0E-31
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 29 293 2.0E-29
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 39 296 4.0E-29
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 186 295 1.0E-10
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 215 293 3.0E-10
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 215 293 3.0E-10
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 215 293 7.0E-10
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 215 293 7.0E-10
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 215 293 7.0E-10
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 215 293 7.0E-10
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 215 293 7.0E-10
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 186 295 2.0E-09
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 213 293 4.0E-09
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 211 294 2.0E-08
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 207 294 3.0E-08
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 214 293 7.0E-08
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 215 293 9.0E-08
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 207 294 1.0E-07
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 211 296 3.0E-07
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 211 296 3.0E-07
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 211 296 3.0E-07
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 217 293 3.0E-07
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 211 296 3.0E-07
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 211 296 3.0E-07
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 211 296 3.0E-07
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 211 296 3.0E-07
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 211 296 5.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 211 296 9.0E-07
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 213 280 1.0E-06
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 211 296 1.0E-06
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 216 279 1.0E-06
sp|Q8N6W0|CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1 197 273 1.0E-06
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 214 273 1.0E-06
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 211 296 1.0E-06
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 213 280 2.0E-06
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 217 292 2.0E-06
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 214 292 2.0E-06
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 211 296 2.0E-06
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 213 280 3.0E-06
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 207 294 3.0E-06
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 229 280 3.0E-06
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 229 280 3.0E-06
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 229 280 3.0E-06
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 218 279 4.0E-06
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 213 280 4.0E-06
sp|Q8L3X8|SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana GN=SCL30 PE=1 SV=1 218 282 5.0E-06
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 207 280 5.0E-06
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 229 289 5.0E-06
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 218 296 8.0E-06
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 164 273 9.0E-06
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 164 273 1.0E-05
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 164 273 1.0E-05
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 211 296 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5831
MATAALLKPKHDWADDDDVEETTTDLPPPQTISNKDGTKTIITFRYNDQGQKVKTTRRIRYVTHTETVNPRVADR
KTWSKFGQSAKDGAGPAPDTTSVGENIIFRPSINWRKDAKDESQDPNTQTMKDKLKDKQVKCRICNGDHFTARCP
YKDTMAPVGENGAADVAAGMGDEPSAGAAGAGKKGSYVPPALRGDRTGAAGERMGGSKYGERDDLATLRVTNVSE
MAEEGELRDMFERFGRVTRVFLAKDRETGMAKGFAFISFADRGDAVKACNKMDGFGFKHLILRVEFAKKTAQ*
Coding >OphauG2|5831
ATGGCGACCGCAGCGCTGCTGAAGCCCAAACACGATTGGGCCGATGATGATGATGTCGAGGAGACAACCACGGAC
CTACCGCCACCGCAGACCATCTCCAATAAAGATGGTACCAAGACCATCATCACGTTCCGTTACAACGATCAAGGC
CAAAAGGTTAAGACGACGCGGAGAATTCGATATGTGACTCACACAGAGACAGTAAATCCTAGAGTCGCAGACCGC
AAGACATGGTCTAAATTTGGTCAGAGCGCCAAAGACGGAGCAGGGCCAGCACCCGACACGACATCAGTAGGCGAG
AATATCATATTTCGGCCCAGCATAAACTGGCGCAAGGACGCAAAAGACGAGAGCCAGGACCCGAATACACAGACA
ATGAAGGACAAACTCAAGGACAAGCAAGTCAAGTGTCGTATTTGCAACGGCGATCACTTCACGGCCAGATGTCCG
TACAAGGACACCATGGCTCCTGTGGGCGAGAATGGTGCAGCCGATGTGGCAGCCGGTATGGGTGACGAACCTTCA
GCAGGTGCTGCTGGAGCTGGAAAGAAAGGTTCATACGTCCCTCCAGCCCTACGTGGCGATCGTACAGGAGCTGCT
GGGGAAAGAATGGGAGGCTCCAAATACGGGGAGCGCGACGACCTTGCAACGCTTCGTGTCACTAATGTTTCTGAA
ATGGCAGAAGAGGGAGAGTTGCGGGACATGTTTGAGCGGTTTGGACGCGTTACCAGAGTCTTCTTGGCCAAGGAT
CGCGAGACAGGCATGGCCAAGGGATTTGCATTCATTAGCTTTGCAGATCGCGGCGACGCTGTCAAGGCGTGCAAC
AAGATGGATGGTTTTGGCTTCAAGCATCTCATCCTCAGAGTCGAGTTCGCCAAGAAGACGGCGCAATAG
Transcript >OphauG2|5831
ATGGCGACCGCAGCGCTGCTGAAGCCCAAACACGATTGGGCCGATGATGATGATGTCGAGGAGACAACCACGGAC
CTACCGCCACCGCAGACCATCTCCAATAAAGATGGTACCAAGACCATCATCACGTTCCGTTACAACGATCAAGGC
CAAAAGGTTAAGACGACGCGGAGAATTCGATATGTGACTCACACAGAGACAGTAAATCCTAGAGTCGCAGACCGC
AAGACATGGTCTAAATTTGGTCAGAGCGCCAAAGACGGAGCAGGGCCAGCACCCGACACGACATCAGTAGGCGAG
AATATCATATTTCGGCCCAGCATAAACTGGCGCAAGGACGCAAAAGACGAGAGCCAGGACCCGAATACACAGACA
ATGAAGGACAAACTCAAGGACAAGCAAGTCAAGTGTCGTATTTGCAACGGCGATCACTTCACGGCCAGATGTCCG
TACAAGGACACCATGGCTCCTGTGGGCGAGAATGGTGCAGCCGATGTGGCAGCCGGTATGGGTGACGAACCTTCA
GCAGGTGCTGCTGGAGCTGGAAAGAAAGGTTCATACGTCCCTCCAGCCCTACGTGGCGATCGTACAGGAGCTGCT
GGGGAAAGAATGGGAGGCTCCAAATACGGGGAGCGCGACGACCTTGCAACGCTTCGTGTCACTAATGTTTCTGAA
ATGGCAGAAGAGGGAGAGTTGCGGGACATGTTTGAGCGGTTTGGACGCGTTACCAGAGTCTTCTTGGCCAAGGAT
CGCGAGACAGGCATGGCCAAGGGATTTGCATTCATTAGCTTTGCAGATCGCGGCGACGCTGTCAAGGCGTGCAAC
AAGATGGATGGTTTTGGCTTCAAGCATCTCATCCTCAGAGTCGAGTTCGCCAAGAAGACGGCGCAATAG
Gene >OphauG2|5831
ATGGCGACCGCAGCGCTGCTGAAGCCCAAGTTAGTTGTCGCCTGTTCCTCGTCAGCATACAAGGGAAATTTTTGC
TCATTATGGACGCAGACACGATTGGGCCGATGATGATGATGTCGAGGAGACAACCACGGACCTACCGCCACCGCA
GACCATCTCCAATAAAGATGGTACCAAGACCATCATCACGTTCCGTTACAACGATCAAGGCCAAAAGGTTAAGAC
GACGCGGAGAATTCGATATGTGACTCACACAGAGACAGTAAATCCTAGAGTCGCAGACCGCAAGACATGGTCTAA
ATTTGGTCAGAGCGCCAAAGACGGAGCAGGGCCAGCACCCGACACGACATCAGTAGGCGAGAATATCATATTTCG
GCCCAGCATAAACTGGCGCAAGGACGCAAAAGACGAGAGCCAGGACCCGAATACACAGACAATGAAGGACAAACT
CAAGGACAAGCAAGTCAAGTGTCGTATTTGCAACGGCGATCACTTCACGGCCAGATGTCCGTACAAGGACACCAT
GGCTCCTGTGGGCGAGAATGGTGCAGCCGATGTGGCAGCCGGTATGGGTGACGAACCTTCAGCAGGTGCTGCTGG
AGCTGGAAAGAAAGGTTCATACGTCCCTCCAGCCCTACGTGGCGATCGTACAGGAGCTGCTGGGGAAAGAATGGG
AGGCTCCAAATACGGGGAGCGCGACGACCTTGCAACGCTTCGTGTCACTAATGTAAGTGGTTGGGGTTTAAATTG
CATGACTATGGGGTTTGGTTGGGAACAAGCTGACAAGTCTGATCAAAGGTTTCTGAAATGGCAGAAGAGGGAGAG
TTGCGGGACATGTTTGAGCGGTTTGGACGCGTTACCAGAGTCTTCTTGGCCAAGGATCGCGAGACAGGCATGGCC
AAGGGATTTGCATTCATTAGCTTTGCAGATCGCGGCGACGCTGTCAAGGCGTGCAACAAGATGGATGGTTTTGGC
TTCAAGCATCTCATCCTCAGAGTCGAGTTCGCCAAGAAGACGGCGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail