Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5828
Gene name
LocationContig_56:28865..30513
Strand+
Gene length (bp)1648
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.3E-16 158 459
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.3E-13 159 505
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.4E-13 154 276
PF06028 DUF915 Alpha/beta hydrolase of unknown function (DUF915) 3.0E-05 197 256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14249|CLD1_SCHPO probable cardiolipin-specific deacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.03c PE=3 SV=1 85 516 4.0E-91
sp|P53264|CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLD1 PE=1 SV=1 128 512 8.0E-55
sp|O22975|LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana GN=At4g24160 PE=1 SV=1 95 507 7.0E-53
sp|Q0J0A4|LPAAT_ORYSJ Probable 1-acylglycerol-3-phosphate O-acyltransferase OS=Oryza sativa subsp. japonica GN=Os09g0520200 PE=3 SV=3 95 507 4.0E-49
sp|Q8VD66|ABHD4_MOUSE Abhydrolase domain-containing protein 4 OS=Mus musculus GN=Abhd4 PE=1 SV=1 141 509 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14249|CLD1_SCHPO probable cardiolipin-specific deacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.03c PE=3 SV=1 85 516 4.0E-91
sp|P53264|CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLD1 PE=1 SV=1 128 512 8.0E-55
sp|O22975|LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana GN=At4g24160 PE=1 SV=1 95 507 7.0E-53
sp|Q0J0A4|LPAAT_ORYSJ Probable 1-acylglycerol-3-phosphate O-acyltransferase OS=Oryza sativa subsp. japonica GN=Os09g0520200 PE=3 SV=3 95 507 4.0E-49
sp|Q8VD66|ABHD4_MOUSE Abhydrolase domain-containing protein 4 OS=Mus musculus GN=Abhd4 PE=1 SV=1 141 509 1.0E-34
sp|Q5EA59|ABHD4_BOVIN Abhydrolase domain-containing protein 4 OS=Bos taurus GN=ABHD4 PE=2 SV=1 141 515 5.0E-34
sp|Q8TB40|ABHD4_HUMAN Abhydrolase domain-containing protein 4 OS=Homo sapiens GN=ABHD4 PE=2 SV=1 141 515 1.0E-33
sp|Q12385|ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICT1 PE=3 SV=1 137 503 3.0E-30
sp|Q5RBI4|ABHD5_PONAB 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Pongo abelii GN=ABHD5 PE=2 SV=1 187 516 4.0E-30
sp|Q8WTS1|ABHD5_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens GN=ABHD5 PE=1 SV=1 187 516 5.0E-30
sp|Q9DBL9|ABHD5_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Mus musculus GN=Abhd5 PE=1 SV=1 187 509 2.0E-29
sp|Q6QA69|ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus GN=Abhd5 PE=1 SV=1 187 509 2.0E-29
sp|Q5EE05|ABHD5_PIG 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Sus scrofa GN=ABHD5 PE=2 SV=1 187 516 2.0E-28
sp|Q04623|ECM18_YEAST Protein ECM18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM18 PE=1 SV=1 160 513 3.0E-26
sp|C7PDD8|PIP_CHIPD Proline iminopeptidase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=Cpin_0261 PE=3 SV=2 167 269 1.0E-06
sp|Q49KF8|MHPC1_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Pseudomonas putida GN=mhpC1 PE=3 SV=2 157 265 4.0E-06
sp|Q13QH4|MHPC_BURXL 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=mhpC PE=3 SV=1 157 265 5.0E-06
sp|P46542|PIP_LACDL Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pip PE=1 SV=1 159 269 5.0E-06
sp|P9WNH5|HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hsaD PE=1 SV=1 156 288 6.0E-06
sp|P9WNH4|HSAD_MYCTO 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hsaD PE=3 SV=1 156 288 6.0E-06
sp|B2JQW2|MHPC_BURP8 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mhpC PE=3 SV=1 157 265 8.0E-06
sp|P46544|PIP_LACDE Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepIP PE=1 SV=2 159 269 9.0E-06
sp|Q1G8L9|PIP_LACDA Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pepIP PE=3 SV=1 159 269 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5828 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1268
Ophiocordyceps camponoti-floridani Ophcf2|04053
Ophiocordyceps camponoti-rufipedis Ophun1|2155
Ophiocordyceps kimflemingae Ophio5|2298
Ophiocordyceps subramaniannii Hirsu2|10904

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5828
MLKTHAASALLQRSRITLAATSSSPSSSSPASPAAKSPITTPIITMPSSHDAHAPPPPQSQQQLKDQRPPESAYF
PLGYKEAAYQWWSSVTPSMAEHNVLSLIPHVREATKTPSSPNTDPHGPRFWRRSLVQLSGKNRALNQVCIQHAGL
SSTPPDETLVMIHGYGAGLGFFYKNLEPISRIPGLRLYALDMLGMGNSSRPCFKIHAKEKNKQVMEAEDWFIDAL
EEWRKERKLDRFTLLGHSLGGYLAVSYAIKYPGHLNKLILASPVGIPEDPYAINASMPDPKDSSLAQEFTQDQQS
VVDNSTISPHTSKNAAVTKAKDANAPKRPLPAWLVWLWDANVSPFSLVRLTGPLGPRLVSGWSSRRFNHLPTQEA
QALHNYSFSIFKQRGSGEYALAYILAPGAYARRPIINRIHEVGRQSVAHPDGSRVKETGIPIVFMYGENDWMDVA
GGLAAEQRIKETSERALRQAASPQDQEAENGSAKVVIIPRSGHHLYLDNPDEFNRVIREEIEDTMQHLKKTRPTA
S*
Coding >OphauG2|5828
ATGCTCAAGACGCACGCTGCCTCGGCGCTTCTTCAACGCTCGCGCATCACTCTCGCTGCCACTTCGTCGTCGCCA
TCCTCATCGTCGCCCGCCTCTCCCGCTGCCAAGAGTCCCATCACCACTCCCATCATTACAATGCCTTCCTCCCAC
GACGCCCATGCCCCGCCCCCGCCTCAGAGCCAGCAGCAACTCAAGGACCAGCGTCCCCCGGAATCCGCCTACTTT
CCTCTGGGCTACAAAGAGGCTGCCTATCAATGGTGGTCCAGTGTCACCCCCTCCATGGCAGAGCACAATGTGCTT
TCTCTAATACCCCATGTCCGCGAGGCCACCAAGACGCCTTCCTCCCCCAATACCGATCCCCACGGCCCTCGTTTC
TGGCGTCGCTCTCTTGTACAGCTCTCAGGGAAAAACCGCGCCCTCAACCAAGTGTGCATCCAACACGCTGGCCTT
TCATCAACCCCTCCCGACGAGACCCTCGTCATGATACATGGCTATGGCGCCGGCTTGGGCTTCTTCTACAAGAAT
CTCGAGCCCATATCCCGCATACCTGGCCTTCGACTCTACGCTCTCGACATGCTCGGAATGGGCAACTCGTCTCGT
CCCTGTTTCAAGATCCACGCCAAGGAAAAGAACAAGCAAGTAATGGAGGCCGAGGACTGGTTTATAGATGCCCTC
GAAGAATGGCGCAAGGAGCGTAAGCTCGACCGCTTCACCCTTCTCGGCCACTCTCTTGGCGGCTATCTGGCCGTT
TCATACGCCATCAAGTATCCTGGCCACTTGAACAAGCTCATTCTCGCCTCCCCCGTTGGCATTCCCGAGGACCCT
TATGCCATTAATGCCTCCATGCCCGATCCAAAAGATTCATCCCTCGCACAGGAATTCACACAGGATCAGCAATCA
GTAGTCGACAACTCGACAATTTCACCCCATACTTCCAAAAATGCCGCTGTTACAAAAGCAAAAGACGCCAATGCA
CCCAAGCGGCCCTTGCCGGCTTGGCTCGTCTGGCTTTGGGATGCAAACGTGTCTCCCTTTAGTCTAGTTCGTCTA
ACGGGGCCTCTGGGTCCACGTCTTGTTTCTGGCTGGAGTTCGCGTCGGTTCAACCACCTTCCTACCCAGGAAGCC
CAAGCCCTGCACAATTACTCGTTTTCCATTTTCAAACAAAGAGGTAGCGGCGAGTACGCTCTCGCATACATACTG
GCTCCTGGGGCCTATGCCCGTAGGCCCATCATCAACCGCATACACGAGGTTGGTCGTCAGTCTGTCGCCCACCCC
GATGGCAGTCGTGTCAAGGAAACTGGAATTCCCATCGTCTTCATGTATGGTGAAAACGATTGGATGGATGTGGCT
GGCGGCCTTGCTGCCGAACAACGCATCAAAGAGACCAGTGAGCGTGCCCTGCGCCAAGCCGCCTCACCCCAAGAT
CAGGAAGCAGAAAATGGCAGTGCCAAAGTTGTCATTATTCCCAGATCCGGCCATCACCTATATCTTGACAATCCA
GACGAATTCAATCGTGTCATACGTGAAGAAATAGAGGATACCATGCAGCATCTCAAAAAAACGCGCCCAACAGCA
TCATGA
Transcript >OphauG2|5828
ATGCTCAAGACGCACGCTGCCTCGGCGCTTCTTCAACGCTCGCGCATCACTCTCGCTGCCACTTCGTCGTCGCCA
TCCTCATCGTCGCCCGCCTCTCCCGCTGCCAAGAGTCCCATCACCACTCCCATCATTACAATGCCTTCCTCCCAC
GACGCCCATGCCCCGCCCCCGCCTCAGAGCCAGCAGCAACTCAAGGACCAGCGTCCCCCGGAATCCGCCTACTTT
CCTCTGGGCTACAAAGAGGCTGCCTATCAATGGTGGTCCAGTGTCACCCCCTCCATGGCAGAGCACAATGTGCTT
TCTCTAATACCCCATGTCCGCGAGGCCACCAAGACGCCTTCCTCCCCCAATACCGATCCCCACGGCCCTCGTTTC
TGGCGTCGCTCTCTTGTACAGCTCTCAGGGAAAAACCGCGCCCTCAACCAAGTGTGCATCCAACACGCTGGCCTT
TCATCAACCCCTCCCGACGAGACCCTCGTCATGATACATGGCTATGGCGCCGGCTTGGGCTTCTTCTACAAGAAT
CTCGAGCCCATATCCCGCATACCTGGCCTTCGACTCTACGCTCTCGACATGCTCGGAATGGGCAACTCGTCTCGT
CCCTGTTTCAAGATCCACGCCAAGGAAAAGAACAAGCAAGTAATGGAGGCCGAGGACTGGTTTATAGATGCCCTC
GAAGAATGGCGCAAGGAGCGTAAGCTCGACCGCTTCACCCTTCTCGGCCACTCTCTTGGCGGCTATCTGGCCGTT
TCATACGCCATCAAGTATCCTGGCCACTTGAACAAGCTCATTCTCGCCTCCCCCGTTGGCATTCCCGAGGACCCT
TATGCCATTAATGCCTCCATGCCCGATCCAAAAGATTCATCCCTCGCACAGGAATTCACACAGGATCAGCAATCA
GTAGTCGACAACTCGACAATTTCACCCCATACTTCCAAAAATGCCGCTGTTACAAAAGCAAAAGACGCCAATGCA
CCCAAGCGGCCCTTGCCGGCTTGGCTCGTCTGGCTTTGGGATGCAAACGTGTCTCCCTTTAGTCTAGTTCGTCTA
ACGGGGCCTCTGGGTCCACGTCTTGTTTCTGGCTGGAGTTCGCGTCGGTTCAACCACCTTCCTACCCAGGAAGCC
CAAGCCCTGCACAATTACTCGTTTTCCATTTTCAAACAAAGAGGTAGCGGCGAGTACGCTCTCGCATACATACTG
GCTCCTGGGGCCTATGCCCGTAGGCCCATCATCAACCGCATACACGAGGTTGGTCGTCAGTCTGTCGCCCACCCC
GATGGCAGTCGTGTCAAGGAAACTGGAATTCCCATCGTCTTCATGTATGGTGAAAACGATTGGATGGATGTGGCT
GGCGGCCTTGCTGCCGAACAACGCATCAAAGAGACCAGTGAGCGTGCCCTGCGCCAAGCCGCCTCACCCCAAGAT
CAGGAAGCAGAAAATGGCAGTGCCAAAGTTGTCATTATTCCCAGATCCGGCCATCACCTATATCTTGACAATCCA
GACGAATTCAATCGTGTCATACGTGAAGAAATAGAGGATACCATGCAGCATCTCAAAAAAACGCGCCCAACAGCA
TCATGA
Gene >OphauG2|5828
ATGCTCAAGACGCACGCTGCCTCGGCGCTTCTTCAACGCTCGCGCATCACTCTCGCTGCCACTTCGTCGTCGCCA
TCCTCATCGTCGCCCGCCTCTCCCGCTGCCAAGAGTCCCATCACCACTCCCATCATTACAATGCCTTCCTCCCAC
GACGCCCATGCCCCGCCCCCGCCTCAGAGCCAGCAGCAACTCAAGGACCAGCGTCCCCCGGAATCCGCCTACTTT
CCTCTGGGCTACAAAGAGGCTGCCTATCAATGGGTACGTAATTCCTCTGTTGCCTGTTGCCACATACAATGCTAT
ACACAAAACCCTAATGCTTCTCTAGTGGTCCAGTGTCACCCCCTCCATGGCAGAGCACAATGTGCTTTCTCTAAT
ACCCCATGTCCGCGAGGCCACCAAGACGCCTTCCTCCCCCAATACCGATCCCCACGGCCCTCGTTTCTGGCGTCG
CTCTCTTGTACAGCTCTCAGGGAAAAACCGCGCCCTCAACCAAGTGTGCATCCAACACGCTGGCCTTTCATCAAC
CCCTCCCGACGAGACCCTCGTCATGATACATGGCTATGGCGCCGGCTTGGGCTTCTTCTACAAGAATCTCGAGCC
CATATCCCGCATACCTGGCCTTCGACTCTACGCTCTCGACATGCTCGGAATGGGCAACTCGTCTCGTCCCTGTTT
CAAGATCCACGCCAAGGAAAAGAACAAGCAAGTAATGGAGGCCGAGGACTGGTTTATAGATGCCCTCGAAGAATG
GCGCAAGGAGCGTAAGCTCGACCGCTTCACCCTTCTCGGCCACTCTCTTGGCGGCTATCTGGCCGTTTCATACGC
CATCAAGTATCCTGGCCACTTGAACAAGCTCATTCTCGCCTCCCCCGTTGGCATTCCCGAGGACCCTTATGCCAT
TAATGCCTCCATGCCCGATCCAAAAGATTCATCCCTCGCACAGGAATTCACACAGGATCAGCAATCAGTAGTCGA
CAACTCGACAATTTCACCCCATACTTCCAAAAATGCCGCTGTTACAAAAGCAAAAGACGCCAATGCACCCAAGCG
GCCCTTGCCGGCTTGGCTCGTCTGGCTTTGGGATGCAAACGTGTCTCCCTTTAGTCTAGTTCGTCTAACGGGGCC
TCTGGGTCCACGTCTTGTTTCTGGCTGGAGTTCGCGTCGGTTCAACCACCTTCCTACCCAGGAAGCCCAAGCCCT
GCACAATTACTCGTTTTCCATTTTCAAACAAAGAGGTAGCGGCGAGTACGCTCTCGCATACATACTGGCTCCTGG
GGCCTATGCCCGTAGGCCCATCATCAACCGCATACACGAGGTTGGTCGTCAGTCTGTCGCCCACCCCGATGGCAG
TCGTGTCAAGGAAACTGGAATTCCCATCGTCTTCATGTATGGTGAAAACGATTGGATGGATGTGGCTGGCGGCCT
TGCTGCCGAACAACGCATCAAAGAGACCAGTGAGCGTGCCCTGCGCCAAGCCGCCTCACCCCAAGATCAGGAAGC
AGAAAATGGCAGTGCCAAAGTTGTCATTATTCCCAGATCCGGCCATCACCTATATCTTGACAATCCAGACGAATT
CAATCGTGTCATACGTGAAGAAATAGAGGATACCATGCAGCATCTCAAAAAAACGCGCCCAACAGCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail