Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5823
Gene name
LocationContig_56:17456..18914
Strand-
Gene length (bp)1458
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 2.0E-08 136 225

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5823 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1273
Ophiocordyceps camponoti-floridani Ophcf2|04060
Ophiocordyceps camponoti-rufipedis Ophun1|2149
Ophiocordyceps kimflemingae Ophio5|2292
Ophiocordyceps subramaniannii Hirsu2|10883

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5823
MTETPLVAELQQVCHVDRRHDLLVWTTPKHGQVGQIELDKVLFILDLSKSEGATIPHFVVCCLKEKTDESAAHAF
QLLLLSTDAVPHALQAEYQLKQMPTHLCGPVDAVVSTKSGLGQALAFWETVLLPLWKLVGEAFGTRGQPDKVFVT
QNANSVRQFARHAHLDADQEQQHTATSRTILLLSGDGGVVDLLNGREQDDTRPVPTVALIPLGTGNALFHSLHKP
VVSNSGSSYLLVALRTLFFGIAAPLPVFKASFSPGSRIVTSAEQLGKTDDEARTIREHAAVSSLYGAIVASYGFH
ASVVYESDTPEYRVHGDKRFGMVAADLLRQSHPYRAKLLIQRQGSLELEREPDETHGYVLVTMVSNLERTFNISP
ASKPLDGQLRLIRFGRLGGDRTMDVMMKAYDGGKHVGMKWDDGKSVEYEGVQEVVVEALDDEARWRKFCIDGTIV
DVPVCGSMTVAKVQGPEMLRVLVDGRVLEAPSAAE*
Coding >OphauG2|5823
ATGACGGAGACGCCGTTAGTTGCTGAGCTCCAGCAAGTTTGCCATGTTGACAGGCGCCACGACCTCCTTGTCTGG
ACGACCCCCAAGCATGGCCAAGTAGGCCAGATTGAACTTGACAAGGTGCTTTTTATTTTGGACTTGTCCAAGTCG
GAAGGCGCAACAATCCCTCATTTTGTTGTTTGTTGTCTGAAGGAGAAGACGGACGAGTCGGCGGCACACGCCTTT
CAACTGCTTCTACTATCGACCGATGCCGTGCCCCATGCTCTGCAGGCAGAGTACCAGCTCAAGCAGATGCCGACG
CACCTTTGCGGCCCTGTTGACGCGGTTGTATCGACCAAGTCTGGTCTTGGACAAGCTCTGGCCTTTTGGGAAACT
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGGGACCAGAGGACAGCCGGACAAGGTTTTTGTAACG
CAAAATGCCAACAGCGTACGACAGTTTGCTCGCCATGCCCATCTTGATGCGGACCAAGAGCAACAGCACACTGCC
ACATCGAGGACAATACTTTTGCTAAGCGGCGATGGCGGGGTGGTTGATCTGCTCAATGGTCGAGAGCAGGACGAC
ACAAGGCCTGTGCCCACTGTTGCTCTTATTCCATTGGGCACTGGAAACGCCTTGTTTCATTCGTTGCACAAGCCC
GTGGTTTCGAATAGCGGTTCGTCGTATCTGCTTGTCGCTCTGCGAACTCTATTCTTTGGCATTGCGGCGCCTCTT
CCTGTATTTAAAGCGTCATTTTCGCCCGGCTCCCGAATCGTTACATCTGCAGAGCAGTTGGGAAAGACAGACGAT
GAGGCACGCACCATAAGGGAGCATGCGGCCGTGTCGAGTCTCTATGGCGCCATTGTTGCTAGCTACGGCTTCCAC
GCTAGCGTCGTCTATGAGAGCGATACACCCGAGTATCGTGTCCACGGGGACAAGCGATTTGGCATGGTGGCTGCA
GACCTTCTCCGCCAGTCTCATCCCTATCGTGCCAAGTTGCTGATACAACGGCAAGGGTCATTGGAGTTGGAGCGA
GAGCCCGACGAGACACACGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGAACTTTTAACATTTCGCCT
GCCAGCAAGCCATTGGACGGCCAGCTGCGTCTGATTCGGTTTGGGCGCTTGGGCGGCGACCGCACAATGGACGTC
ATGATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAAGTGGGACGATGGCAAGAGCGTCGAGTATGAGGGG
GTGCAAGAGGTTGTCGTGGAGGCGCTGGACGATGAGGCACGCTGGCGCAAGTTTTGCATCGACGGTACCATTGTT
GATGTGCCTGTTTGCGGTTCCATGACTGTGGCCAAGGTTCAAGGACCCGAAATGTTGCGCGTCTTGGTTGATGGG
CGAGTTTTGGAGGCGCCGAGTGCAGCGGAGTAG
Transcript >OphauG2|5823
ATGACGGAGACGCCGTTAGTTGCTGAGCTCCAGCAAGTTTGCCATGTTGACAGGCGCCACGACCTCCTTGTCTGG
ACGACCCCCAAGCATGGCCAAGTAGGCCAGATTGAACTTGACAAGGTGCTTTTTATTTTGGACTTGTCCAAGTCG
GAAGGCGCAACAATCCCTCATTTTGTTGTTTGTTGTCTGAAGGAGAAGACGGACGAGTCGGCGGCACACGCCTTT
CAACTGCTTCTACTATCGACCGATGCCGTGCCCCATGCTCTGCAGGCAGAGTACCAGCTCAAGCAGATGCCGACG
CACCTTTGCGGCCCTGTTGACGCGGTTGTATCGACCAAGTCTGGTCTTGGACAAGCTCTGGCCTTTTGGGAAACT
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGGGACCAGAGGACAGCCGGACAAGGTTTTTGTAACG
CAAAATGCCAACAGCGTACGACAGTTTGCTCGCCATGCCCATCTTGATGCGGACCAAGAGCAACAGCACACTGCC
ACATCGAGGACAATACTTTTGCTAAGCGGCGATGGCGGGGTGGTTGATCTGCTCAATGGTCGAGAGCAGGACGAC
ACAAGGCCTGTGCCCACTGTTGCTCTTATTCCATTGGGCACTGGAAACGCCTTGTTTCATTCGTTGCACAAGCCC
GTGGTTTCGAATAGCGGTTCGTCGTATCTGCTTGTCGCTCTGCGAACTCTATTCTTTGGCATTGCGGCGCCTCTT
CCTGTATTTAAAGCGTCATTTTCGCCCGGCTCCCGAATCGTTACATCTGCAGAGCAGTTGGGAAAGACAGACGAT
GAGGCACGCACCATAAGGGAGCATGCGGCCGTGTCGAGTCTCTATGGCGCCATTGTTGCTAGCTACGGCTTCCAC
GCTAGCGTCGTCTATGAGAGCGATACACCCGAGTATCGTGTCCACGGGGACAAGCGATTTGGCATGGTGGCTGCA
GACCTTCTCCGCCAGTCTCATCCCTATCGTGCCAAGTTGCTGATACAACGGCAAGGGTCATTGGAGTTGGAGCGA
GAGCCCGACGAGACACACGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGAACTTTTAACATTTCGCCT
GCCAGCAAGCCATTGGACGGCCAGCTGCGTCTGATTCGGTTTGGGCGCTTGGGCGGCGACCGCACAATGGACGTC
ATGATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAAGTGGGACGATGGCAAGAGCGTCGAGTATGAGGGG
GTGCAAGAGGTTGTCGTGGAGGCGCTGGACGATGAGGCACGCTGGCGCAAGTTTTGCATCGACGGTACCATTGTT
GATGTGCCTGTTTGCGGTTCCATGACTGTGGCCAAGGTTCAAGGACCCGAAATGTTGCGCGTCTTGGTTGATGGG
CGAGTTTTGGAGGCGCCGAGTGCAGCGGAGTAG
Gene >OphauG2|5823
ATGACGGAGACGCCGTTAGTTGCTGAGCTCCAGCAAGTTTGCCATGTTGACAGGCGCCACGACCTCCTTGTCTGG
ACGACCCCCAAGCATGGCCAAGTAGGCCAGATTGAACTTGACAAGGTGCTTTTTATTTTGGACTTGTCCAAGTCG
GAAGGCGCAACAATCCCTCATTTTGTTGTTTGTTGTCTGAAGGAGAAGACGGACGAGTCGGCGGCACACGCCTTT
CAACTGCTTCTACTATCGACCGATGCCGTGCCCCATGCTCTGCAGGCAGAGTACCAGCTCAAGCAGATGCCGACG
CACCTTTGCGGCCCTGTTGACGCGGTTGTATCGACCAAGTCTGGTCTTGGACAAGCTCTGGCCTTTTGGGAAACT
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGGGACCAGAGGACAGCCGGACAAGGTTTTTGTAACG
CAAAATGCCAACAGCGTACGACAGTTTGCTCGCCATGCCCATCTTGATGCGGACCAAGAGCAACAGCACACTGCC
ACATCGAGGACAATACTTTTGCTAAGCGGCGATGGCGGGGTGGTTGATCTGCTCAATGGTCGAGAGCAGGACGAC
ACAAGGCCTGTGCCCACTGTTGCTCTTATTCCATTGGGCACTGGAAACGCCTTGTTTCATTCGTTGCACAAGCCC
GTGGTTTCGAATAGCGGTTCGTCGTATCTGCTTGTCGCTCTGCGAACTCTATTCTTTGGCATTGCGGCGCCTCTT
CCTGTATTTAAAGCGTCATTTTCGCCCGGCTCCCGAATCGTTACATCTGCAGAGCAGTTGGGAAAGACAGACGAT
GAGGCACGCACCATAAGGGAGCATGCGGCCGTGTCGAGTCTCTATGGCGCCATTGTTGCTAGCTACGGCTTCCAC
GCTAGCGTCGTCTATGAGAGCGATACACCCGAGTATCGTGTCCACGGGGACAAGCGATTTGGCATGGTGGCTGCA
GACCTTCTCCGCCAGTCTCATCCCTATCGTGCCAAGTTGCTGATACAACGGCAAGGGTCATTGGAGTTGGAGCGA
GAGCCCGACGAGACACACGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGAACTTTTAACATTTCGCCT
GCCAGCAAGCCATTGGACGGCCAGCTGCGTCTGATTCGGTTTGGGCGCTTGGGCGGCGACCGCACAATGGACGTC
ATGATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAAGTGGGACGATGGCAAGAGCGTCGAGTATGAGGGG
GTGCAAGAGGTTGTCGTGGAGGCGCTGGACGATGAGGCACGCTGGCGCAAGTTTTGCATCGACGGTACCATTGTT
GATGTGCCTGTTTGCGGTTCCATGACTGTGGCCAAGGTTCAAGGACCCGAAATGTTGCGCGTCTTGGTTGATGGG
CGAGTTTTGGAGGCGCCGAGTGCAGCGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail