Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5817
Gene name
LocationContig_559:8885..9479
Strand+
Gene length (bp)594
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09282 Mago-bind Mago binding 6.8E-15 17 43

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q640E9|WIBG_XENLA Partner of Y14 and mago OS=Xenopus laevis GN=wibg PE=2 SV=1 10 182 1.0E-07
sp|Q8CHP5|WIBG_MOUSE Partner of Y14 and mago OS=Mus musculus GN=Wibg PE=1 SV=2 19 168 1.0E-06
sp|Q6PH11|WIBG_DANRE Partner of Y14 and mago OS=Danio rerio GN=wibg PE=2 SV=1 10 179 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5817
MPSETTNSGIVTDGDSGERHIPESTRADGSTRKAIKIRPGYRPPEDVEIYKNRTAESFRQRGKKIGIPGAAGLVD
DKSEQAESASSISTKNAKRREARRKAKAAVADGLNESPKQPTEPPRPEEADSQLERDKKGRNLKKRLKQARELEN
KKNGGETLLPEQIAKVIKINELIRELKSLGIDDTEEPREISEVAQVK*
Coding >OphauG2|5817
ATGCCCTCCGAGACGACCAACTCGGGAATCGTTACAGACGGAGACAGTGGCGAACGTCACATCCCTGAATCGACA
CGAGCCGATGGCAGCACTCGAAAAGCCATCAAGATTCGTCCTGGCTACCGACCACCAGAGGACGTGGAAATTTAC
AAGAATCGCACCGCTGAGTCGTTCCGCCAACGGGGCAAAAAAATAGGCATTCCTGGAGCTGCAGGTCTTGTAGAC
GACAAGTCAGAACAGGCCGAGTCAGCATCAAGTATTAGCACCAAGAATGCAAAGAGGCGCGAGGCTAGAAGGAAA
GCCAAGGCGGCCGTCGCAGACGGACTCAATGAGTCGCCCAAGCAACCTACAGAGCCTCCGAGGCCGGAAGAGGCT
GACTCACAACTTGAACGGGATAAGAAGGGTCGTAATCTCAAAAAGAGGCTGAAACAGGCGAGAGAGCTTGAAAAC
AAGAAGAATGGAGGAGAGACGTTGCTGCCGGAGCAGATTGCAAAAGTTATTAAGATTAACGAGCTCATCCGGGAA
CTGAAATCACTGGGTATCGACGACACCGAAGAGCCGCGAGAAATATCCGAAGTAGCCCAAGTCAAATGA
Transcript >OphauG2|5817
ATGCCCTCCGAGACGACCAACTCGGGAATCGTTACAGACGGAGACAGTGGCGAACGTCACATCCCTGAATCGACA
CGAGCCGATGGCAGCACTCGAAAAGCCATCAAGATTCGTCCTGGCTACCGACCACCAGAGGACGTGGAAATTTAC
AAGAATCGCACCGCTGAGTCGTTCCGCCAACGGGGCAAAAAAATAGGCATTCCTGGAGCTGCAGGTCTTGTAGAC
GACAAGTCAGAACAGGCCGAGTCAGCATCAAGTATTAGCACCAAGAATGCAAAGAGGCGCGAGGCTAGAAGGAAA
GCCAAGGCGGCCGTCGCAGACGGACTCAATGAGTCGCCCAAGCAACCTACAGAGCCTCCGAGGCCGGAAGAGGCT
GACTCACAACTTGAACGGGATAAGAAGGGTCGTAATCTCAAAAAGAGGCTGAAACAGGCGAGAGAGCTTGAAAAC
AAGAAGAATGGAGGAGAGACGTTGCTGCCGGAGCAGATTGCAAAAGTTATTAAGATTAACGAGCTCATCCGGGAA
CTGAAATCACTGGGTATCGACGACACCGAAGAGCCGCGAGAAATATCCGAAGTAGCCCAAGTCAAATGA
Gene >OphauG2|5817
ATGCCCTCCGAGACGACCAACTCGGGAATCGTTACAGACGGAGACAGTGGCGAACGTCACATCCCTGAATCGACA
CGAGCCGATGGCAGCACTCGAAAAGCCATCAAGATTCGTCCTGGCTACCGACCACCAGAGGACGTGGAAATTTAC
AAGAATCGCACCGCTGAGTCGTTCCGCCAACGGGGCAAAAAAATAGGCATTCCTGGAGCTGCAGGTCTTGTAGAC
GACAAGTCAGAACAGGCCGAGTCAGCATCAAGTATTAGCACCAAGAATGCAAAGAGGCGCGAGGCTAGAAGGAAA
GCCAAGGCGGCCGTCGCAGACGGACTCAATGAGTCGCCCAAGCAACCTACAGAGCCTCCGAGGCCGGAAGAGGCT
GACTCACAACTTGAACGGGATAAGAAGGGTCGTAATCTCAAAAAGAGGCTGAAACAGGCGAGAGAGCTTGAAAAC
AAGAAGAATGGAGGAGAGACGTTGCTGCCGGAGCAGATTGCAAAAGTTATTAAGATTAACGAGCTCATCCGGGAA
CTGAAATCACTGGGTATCGACGACACCGAAGAGCCGCGAGAAATATCCGAAGTAGCCCAAGTCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail