Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5812
Gene name
LocationContig_558:4931..5825
Strand+
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 6.1E-06 37 124

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup663
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5812 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5813
Ophiocordyceps australis map64 (Brazil) OphauB2|2829
Ophiocordyceps australis map64 (Brazil) OphauB2|7152
Ophiocordyceps subramaniannii Hirsu2|10815
Ophiocordyceps subramaniannii Hirsu2|7032

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5812
MQSEHGIQGTPSTDQASEHGPSAYVTLSTAGATRRSRSASWLYRIHAAPNIIDASTRDCEQETHIFALGGVPWTQ
VMAWSEVNFDSDVELIQHRVKESGFTPNPDYNSDGFGALDAHVVSPSSDWRFTGAEFWNPRDHYDAPRLSRQHWT
THMASLPECARQALGFDVDFPLVFGRGNSPISSQRSTCLQRPTLSHSANPVSLLNTPQVLTAIDYLSSTDEPCNV
ASLDVSARQQTLGTDALLFRSIVRLSCQNEHALRSVSPSSEAVLDRLAEGYEPATCHLIAMCNNFLQDQRGR*
Coding >OphauG2|5812
ATGCAGAGCGAGCATGGCATACAAGGCACTCCAAGCACAGATCAGGCCAGTGAGCACGGGCCAAGTGCTTATGTG
ACGCTATCGACGGCTGGCGCAACGAGAAGAAGCCGCAGCGCCTCCTGGCTGTACCGCATCCATGCGGCGCCCAAT
ATCATCGATGCCTCGACGAGAGACTGCGAGCAAGAGACCCACATCTTTGCTCTGGGCGGCGTGCCGTGGACACAG
GTCATGGCATGGAGCGAGGTCAACTTTGATAGCGACGTCGAGCTTATCCAGCACCGGGTGAAAGAGTCTGGCTTT
ACGCCTAACCCAGACTACAATAGCGACGGCTTCGGCGCTCTAGACGCCCACGTCGTGAGTCCCAGCAGCGACTGG
CGCTTCACAGGCGCCGAGTTTTGGAATCCACGCGACCACTATGACGCTCCTCGGCTCAGCAGACAGCACTGGACG
ACGCACATGGCAAGCCTACCAGAATGTGCTCGACAAGCCCTGGGCTTTGACGTCGACTTCCCCCTCGTGTTTGGA
CGTGGCAACTCTCCCATTTCTTCTCAGCGGTCCACTTGTCTACAGCGACCAACTTTGAGCCACAGCGCCAACCCA
GTCTCGCTCCTCAACACGCCACAAGTCTTGACAGCGATTGACTACCTATCCAGCACTGACGAGCCATGCAACGTT
GCCAGCCTCGACGTCTCGGCGCGCCAGCAGACTCTGGGCACGGATGCCTTGCTCTTCCGTTCCATTGTCCGCCTG
TCCTGCCAGAACGAGCATGCCCTCAGGTCCGTCTCGCCATCAAGCGAGGCCGTGCTAGACAGGTTGGCCGAGGGG
TACGAGCCCGCGACGTGCCATCTAATTGCCATGTGCAACAATTTTTTGCAAGACCAACGAGGGAGGTAA
Transcript >OphauG2|5812
ATGCAGAGCGAGCATGGCATACAAGGCACTCCAAGCACAGATCAGGCCAGTGAGCACGGGCCAAGTGCTTATGTG
ACGCTATCGACGGCTGGCGCAACGAGAAGAAGCCGCAGCGCCTCCTGGCTGTACCGCATCCATGCGGCGCCCAAT
ATCATCGATGCCTCGACGAGAGACTGCGAGCAAGAGACCCACATCTTTGCTCTGGGCGGCGTGCCGTGGACACAG
GTCATGGCATGGAGCGAGGTCAACTTTGATAGCGACGTCGAGCTTATCCAGCACCGGGTGAAAGAGTCTGGCTTT
ACGCCTAACCCAGACTACAATAGCGACGGCTTCGGCGCTCTAGACGCCCACGTCGTGAGTCCCAGCAGCGACTGG
CGCTTCACAGGCGCCGAGTTTTGGAATCCACGCGACCACTATGACGCTCCTCGGCTCAGCAGACAGCACTGGACG
ACGCACATGGCAAGCCTACCAGAATGTGCTCGACAAGCCCTGGGCTTTGACGTCGACTTCCCCCTCGTGTTTGGA
CGTGGCAACTCTCCCATTTCTTCTCAGCGGTCCACTTGTCTACAGCGACCAACTTTGAGCCACAGCGCCAACCCA
GTCTCGCTCCTCAACACGCCACAAGTCTTGACAGCGATTGACTACCTATCCAGCACTGACGAGCCATGCAACGTT
GCCAGCCTCGACGTCTCGGCGCGCCAGCAGACTCTGGGCACGGATGCCTTGCTCTTCCGTTCCATTGTCCGCCTG
TCCTGCCAGAACGAGCATGCCCTCAGGTCCGTCTCGCCATCAAGCGAGGCCGTGCTAGACAGGTTGGCCGAGGGG
TACGAGCCCGCGACGTGCCATCTAATTGCCATGTGCAACAATTTTTTGCAAGACCAACGAGGGAGGTAA
Gene >OphauG2|5812
ATGCAGAGCGAGCATGGCATACAAGGCACTCCAAGCACAGATCAGGCCAGTGAGCACGGGCCAAGTGCTTATGTG
ACGCTATCGACGGCTGGCGCAACGAGAAGAAGCCGCAGCGCCTCCTGGCTGTACCGCATCCATGCGGCGCCCAAT
ATCATCGATGCCTCGACGAGAGACTGCGAGCAAGAGACCCACATCTTTGCTCTGGGCGGCGTGCCGTGGACACAG
GTCATGGCATGGAGCGAGGTCAACTTTGATAGCGACGTCGAGCTTATCCAGCACCGGGTGAAAGAGTCTGGCTTT
ACGCCTAACCCAGACTACAATAGCGACGGCTTCGGCGCTCTAGACGCCCACGTCGTGAGTCCCAGCAGCGACTGG
CGCTTCACAGGCGCCGAGTTTTGGAATCCACGCGACCACTATGACGCTCCTCGGCTCAGCAGACAGCACTGGACG
ACGCACATGGCAAGCCTACCAGAATGTGCTCGACAAGCCCTGGGCTTTGACGTCGACTTCCCCCTCGTGTTTGGA
CGTGGCAACTCTCCCATTTCTTCTCAGCGGTCCACTTGTCTACAGCGACCAACTTTGAGCCACAGCGCCAACCCA
GTCTCGCTCCTCAACACGCCACAAGTCTTGACAGCGATTGACTACCTATCCAGCACTGACGAGCCATGCAACGTT
GCCAGCCTCGACGTCTCGGCGCGCCAGCAGACTCTGGGCACGGATGCCTTGCTCTTCCGTTCCATTGTCCGCCTG
TCCTGCCAGAACGAGCATGCCCTCAGGTCCGTCTCGCCATCAAGCGAGGCCGTGCTAGACAGGTTGGCCGAGGGG
TACGAGCCCGCGACGTGCCATCTAATTGCCATGTGCAACAATTTTTTGCAAGACCAACGAGGGAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail