Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5807
Gene name
LocationContig_557:6364..9637
Strand+
Gene length (bp)3273
Transcript length (bp)3015
Coding sequence length (bp)3015
Protein length (aa) 1005

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12812 PDZ_1 PDZ-like domain 3.6E-33 383 458
PF12812 PDZ_1 PDZ-like domain 4.7E-17 857 934
PF13365 Trypsin_2 Trypsin-like peptidase domain 5.6E-14 98 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DAL3|NM111_PICGU Pro-apoptotic serine protease NMA111 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NMA111 PE=3 SV=2 36 971 0.0E+00
sp|A4RJH4|NM111_MAGO7 Pro-apoptotic serine protease NMA111 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NMA111 PE=3 SV=1 1 1000 0.0E+00
sp|Q6CIT6|NM111_KLULA Pro-apoptotic serine protease NMA111 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMA111 PE=3 SV=1 76 968 0.0E+00
sp|A6ZRW1|NM111_YEAS7 Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain YJM789) GN=NMA111 PE=3 SV=1 78 969 0.0E+00
sp|P53920|NM111_YEAST Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA111 PE=1 SV=1 78 969 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DAL3|NM111_PICGU Pro-apoptotic serine protease NMA111 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NMA111 PE=3 SV=2 36 971 0.0E+00
sp|A4RJH4|NM111_MAGO7 Pro-apoptotic serine protease NMA111 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NMA111 PE=3 SV=1 1 1000 0.0E+00
sp|Q6CIT6|NM111_KLULA Pro-apoptotic serine protease NMA111 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMA111 PE=3 SV=1 76 968 0.0E+00
sp|A6ZRW1|NM111_YEAS7 Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain YJM789) GN=NMA111 PE=3 SV=1 78 969 0.0E+00
sp|P53920|NM111_YEAST Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA111 PE=1 SV=1 78 969 0.0E+00
sp|A7TGI3|NM111_VANPO Pro-apoptotic serine protease NMA111 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NMA111 PE=3 SV=1 77 975 0.0E+00
sp|Q75D90|NM111_ASHGO Pro-apoptotic serine protease NMA111 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NMA111 PE=3 SV=2 66 969 0.0E+00
sp|A3LX99|NM111_PICST Pro-apoptotic serine protease NMA111 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NMA111 PE=3 SV=1 7 967 0.0E+00
sp|Q6FLE2|NM111_CANGA Pro-apoptotic serine protease NMA111 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NMA111 PE=3 SV=1 77 984 0.0E+00
sp|A5DVI0|NM111_LODEL Pro-apoptotic serine protease NMA111 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NMA111 PE=3 SV=1 60 969 0.0E+00
sp|Q9P7S1|YIFC_SCHPO PDZ domain-containing protein C23G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23G3.12c PE=2 SV=1 77 981 0.0E+00
sp|Q6BKM0|NM111_DEBHA Pro-apoptotic serine protease NMA111 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NMA111 PE=3 SV=2 8 981 0.0E+00
sp|Q6BZQ9|NM111_YARLI Pro-apoptotic serine protease NMA111 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NMA111 PE=3 SV=2 49 1004 0.0E+00
sp|Q0UY70|NM111_PHANO Pro-apoptotic serine protease NMA111 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NMA111 PE=3 SV=2 76 981 0.0E+00
sp|A6RG85|NM111_AJECN Pro-apoptotic serine protease NMA111 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NMA111 PE=3 SV=2 77 981 0.0E+00
sp|Q1E3N5|NM111_COCIM Pro-apoptotic serine protease NMA111 OS=Coccidioides immitis (strain RS) GN=NMA111 PE=3 SV=2 76 988 0.0E+00
sp|A1CUK5|NM111_ASPCL Pro-apoptotic serine protease nma111 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nma111 PE=3 SV=1 1 988 0.0E+00
sp|A5AB13|NM111_ASPNC Pro-apoptotic serine protease nma111 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nma111 PE=3 SV=2 9 988 0.0E+00
sp|Q2TYB1|NM111_ASPOR Pro-apoptotic serine protease nma111 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nma111 PE=3 SV=1 1 988 0.0E+00
sp|Q4WLG1|NM111_ASPFU Pro-apoptotic serine protease nma111 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nma111 PE=3 SV=1 1 988 0.0E+00
sp|Q0CSC0|NM111_ASPTN Pro-apoptotic serine protease nma111 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nma111 PE=3 SV=2 9 988 0.0E+00
sp|A1DP85|NM111_NEOFI Pro-apoptotic serine protease nma111 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nma111 PE=3 SV=2 1 988 0.0E+00
sp|Q7S9D2|NM111_NEUCR Pro-apoptotic serine protease nma111 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nma111 PE=3 SV=1 1 994 0.0E+00
sp|Q2H334|NM111_CHAGB Pro-apoptotic serine protease NMA111 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NMA111 PE=3 SV=1 1 1004 0.0E+00
sp|O74325|YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1685.05 PE=4 SV=1 33 970 9.0E-129
sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 77 522 4.0E-89
sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 551 977 2.0E-54
sp|P72780|HHOA_SYNY3 Putative serine protease HhoA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoA PE=1 SV=1 99 384 2.0E-12
sp|P73354|HTRA_SYNY3 Putative serine protease HtrA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=htrA PE=1 SV=1 99 385 2.0E-08
sp|Q8YG32|DEGPL_BRUME Probable periplasmic serine endoprotease DegP-like OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=htrA PE=3 SV=1 98 342 1.0E-07
sp|P0A3Z5|DEGPL_BRUSU Probable periplasmic serine endoprotease DegP-like OS=Brucella suis biovar 1 (strain 1330) GN=htrA PE=3 SV=1 98 342 1.0E-07
sp|P0C114|DEGPL_BRUAB Probable periplasmic serine endoprotease DegP-like OS=Brucella abortus biovar 1 (strain 9-941) GN=htrA PE=3 SV=1 98 342 1.0E-07
sp|Q2YMX6|DEGPL_BRUA2 Probable periplasmic serine endoprotease DegP-like OS=Brucella abortus (strain 2308) GN=htrA PE=3 SV=1 98 342 1.0E-07
sp|Q6GI62|HTRAL_STAAR Serine protease HtrA-like OS=Staphylococcus aureus (strain MRSA252) GN=SAR0992 PE=3 SV=1 98 377 2.0E-07
sp|E1V4H2|DEGPL_HALED Probable periplasmic serine endoprotease DegP-like OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=mucD PE=3 SV=1 98 379 5.0E-07
sp|Q52894|DEGPL_RHIME Probable periplasmic serine endoprotease DegP-like OS=Rhizobium meliloti (strain 1021) GN=degP1 PE=3 SV=2 98 380 6.0E-07
sp|P54925|DEGPL_BARHE Probable periplasmic serine endoprotease DegP-like OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=htrA PE=3 SV=2 98 377 9.0E-07
sp|Q6GAJ1|HTRAL_STAAS Serine protease HtrA-like OS=Staphylococcus aureus (strain MSSA476) GN=SAS0955 PE=3 SV=1 98 377 1.0E-06
sp|Q99V70|HTRAL_STAAM Serine protease HtrA-like OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1023 PE=3 SV=1 98 377 1.0E-06
sp|Q7A6C9|HTRAL_STAAN Serine protease HtrA-like OS=Staphylococcus aureus (strain N315) GN=SA0879 PE=1 SV=1 98 377 1.0E-06
sp|Q5HH63|HTRAL_STAAC Serine protease HtrA-like OS=Staphylococcus aureus (strain COL) GN=SACOL1028 PE=3 SV=1 98 377 1.0E-06
sp|Q8NXB8|HTRAL_STAAW Serine protease HtrA-like OS=Staphylococcus aureus (strain MW2) GN=MW0903 PE=3 SV=1 98 377 1.0E-06
sp|Q2FI55|HTRAL_STAA3 Serine protease HtrA-like OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0923 PE=3 SV=1 98 377 1.0E-06
sp|F1N152|HTRA1_BOVIN Serine protease HTRA1 OS=Bos taurus GN=HTRA1 PE=2 SV=1 65 375 2.0E-06
sp|Q48EU9|DEGPL_PSE14 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mucD PE=3 SV=1 98 456 4.0E-06
sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 98 456 4.0E-06
sp|P0C0V1|DEGP_ECO57 Periplasmic serine endoprotease DegP OS=Escherichia coli O157:H7 GN=degP PE=3 SV=1 98 456 4.0E-06
sp|Q2FZP2|HTRAL_STAA8 Serine protease HtrA-like OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00958 PE=3 SV=2 98 377 4.0E-06
sp|D3ZA76|HTRA3_RAT Serine protease HTRA3 OS=Rattus norvegicus GN=Htra3 PE=2 SV=1 158 375 5.0E-06
sp|A6YFB5|HTRA1_XENLA Serine protease HTRA1 OS=Xenopus laevis GN=htra1 PE=1 SV=1 134 375 5.0E-06
sp|Q9PL97|DEGPL_CHLMU Probable periplasmic serine endoprotease DegP-like OS=Chlamydia muridarum (strain MoPn / Nigg) GN=htrA PE=3 SV=1 98 454 7.0E-06
sp|P26982|DEGP_SALTY Periplasmic serine endoprotease DegP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=degP PE=3 SV=1 90 377 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2476
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5807 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2740
Ophiocordyceps camponoti-floridani Ophcf2|04028
Ophiocordyceps camponoti-rufipedis Ophun1|474
Ophiocordyceps kimflemingae Ophio5|3961
Ophiocordyceps subramaniannii Hirsu2|3575

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5807
MNGSRAAVSGKRRAASSPSSDNAPPVKRMLNGRLSADDNTPDCGYADFDDSSDLSHPGGPHGLVPPMYIGTPGSL
GEWQDTIQKVVRNVVAIRFCQTYIMTNRHVVGAGPFWGHCVFDNHEEVDCRPVYRDPVHDFGILRYDPKAIKYMH
VDGLDLRPDLAKGMWNPLSFGVEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDFNTCYYQANAAASGGSS
GSPVVSKDGSAVALQAGGRCDGPSTDYFLPLDRPLRALKCIQQGKPVTRGDVQCQFLLKPFDECRRLGLSPEWEA
AMRKAFPDETNMLVAEIILPSGPSHLKIEEGDVLIKVNGELITQFIRLDDILDSHVGKTIKFQLQRGGQNVEVEI
QVGDLHGITPDRFISIAGASFHNLSYQQARLYAVAVQGVFVCESAGSFRFDTSDHGWIIHTVDHKKVPDLDTFVQ
VMKTIPDKARVVATYKHLRDLHTLNTSVLYIDRHWSSKMKLAVRNDETGMWDFTDLGDALPPVSPVRRSASFIEL
DHMPHPGIAELIRSFVHVNCTMPMKLDGFPKNRRWGMGLVIDADKGLVLISRAIVPYDLCDITVTIADSIFVEAK
VIFLHPLQNYAIIKYDPSLVDAPVRSARMSDQHLAQGAKTYFVGYNRIGRVVHGSTTVTEITAVAIPANSGAPRY
RAVNVDAITIDSNLGSTCNSGVLVASDGTVQALWLSYLGERSPCSQRDEEYYLGLGTPTLLPVVSTVQRGETPQL
RMLSVELRSVQMAQARVMGVSDEWIKKVTEANPSHHQLFMVSKRTFERGEHPVSLVEGDIVLKLNGKMCTTISDF
DVMYSTDVLDAVIVRECEELHLRLPTVAAKDMETDRAVSFCGAILHRPHHAVRQQISKLHSEVYVSSRIRGSPAY
QYGVAPTNFITHVNGRSTPDLESFIEATRQIPDNTYFRLKAVTFDSVPWVITMKKNDHYFPTVEWIKDSSEECGW
RRVTYEGTKVVEGESTEGVPAMAEDTEME*
Coding >OphauG2|5807
ATGAACGGCTCACGGGCTGCAGTCTCGGGCAAGCGACGAGCAGCCTCTTCTCCTTCCTCGGACAACGCGCCACCG
GTTAAGCGAATGCTCAACGGCCGACTGTCTGCCGACGATAACACTCCCGACTGTGGCTATGCCGACTTTGACGAC
AGCTCGGATCTGTCGCATCCAGGCGGGCCGCACGGCCTGGTCCCGCCCATGTATATTGGAACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAATGTGGTTGCCATTCGCTTCTGCCAAACGTACATCATG
ACCAATCGCCACGTTGTCGGCGCCGGCCCCTTCTGGGGTCATTGCGTCTTCGACAATCACGAAGAAGTTGACTGC
CGTCCGGTATACCGCGACCCCGTTCACGATTTCGGAATTTTGCGCTACGACCCCAAAGCTATCAAGTATATGCAC
GTTGACGGCCTTGACCTGAGGCCAGATCTGGCAAAAGGCATGTGGAACCCGCTGTCCTTTGGTGTCGAGATTCGC
GTTGTTGGCAACGACGCCGGCGAGAAGCTCAGTATCCTATCAGGCGTCATCAGTCGCCTCGACCGCAATGCTCCC
GAGTACGGCGAGGGATACAGCGACTTCAATACGTGCTACTACCAGGCCAACGCCGCCGCTAGTGGAGGCAGCTCT
GGCAGCCCCGTCGTCAGCAAGGATGGCTCGGCTGTGGCCCTCCAGGCTGGTGGTCGATGCGACGGACCCTCAACC
GATTACTTCCTTCCCCTGGATCGCCCGCTACGCGCCCTCAAATGCATCCAGCAGGGCAAGCCCGTCACTCGTGGC
GACGTACAGTGCCAGTTCTTGCTCAAGCCCTTTGACGAATGTCGTCGGCTAGGACTCAGTCCTGAGTGGGAGGCT
GCTATGCGCAAGGCGTTTCCAGATGAAACCAACATGCTTGTGGCTGAGATTATTCTGCCCTCTGGTCCTTCGCAT
CTCAAGATTGAAGAAGGCGATGTGCTCATCAAAGTCAATGGAGAACTCATTACCCAGTTTATCAGGTTGGACGAT
ATTCTTGACTCCCATGTAGGCAAGACCATCAAGTTCCAGCTTCAACGCGGTGGCCAGAACGTTGAAGTGGAAATT
CAAGTTGGCGACCTCCATGGCATCACGCCCGATCGCTTCATATCTATTGCTGGCGCCAGCTTCCACAACCTGTCG
TACCAGCAAGCAAGACTCTACGCTGTGGCCGTACAGGGCGTATTCGTTTGCGAATCGGCTGGCTCATTCCGCTTT
GACACCTCGGACCATGGATGGATCATCCACACTGTCGACCACAAAAAGGTGCCAGATTTAGACACCTTTGTCCAG
GTCATGAAGACGATTCCTGACAAGGCCAGAGTCGTGGCGACGTACAAGCATCTGCGTGACCTACATACGCTCAAT
ACATCGGTCCTGTACATTGACCGCCACTGGTCCTCCAAGATGAAGCTGGCGGTGCGAAACGACGAGACGGGCATG
TGGGATTTTACAGATCTGGGAGACGCGCTGCCGCCAGTCTCGCCCGTTCGCCGGTCGGCCTCGTTTATCGAGCTC
GACCATATGCCCCATCCGGGCATTGCGGAGCTGATTCGGAGCTTTGTCCACGTCAACTGCACAATGCCCATGAAA
CTCGACGGTTTCCCTAAGAACAGGCGTTGGGGCATGGGCCTTGTCATTGATGCTGACAAGGGCCTGGTGCTCATC
TCGCGAGCCATTGTGCCATATGACCTTTGCGACATTACTGTCACTATTGCTGATTCCATTTTTGTCGAGGCAAAG
GTTATATTTTTGCACCCGCTACAAAACTACGCCATCATCAAGTACGACCCGTCGCTTGTTGATGCGCCCGTCAGG
AGCGCGAGGATGAGCGACCAGCACCTAGCGCAAGGAGCCAAGACGTATTTTGTCGGCTACAACAGGATTGGTCGC
GTGGTGCACGGCTCGACGACGGTGACGGAAATCACTGCTGTGGCCATACCAGCCAACTCGGGGGCGCCGCGCTAC
CGCGCCGTCAATGTTGACGCCATTACCATTGATAGCAACCTAGGGTCTACTTGCAACAGCGGCGTCCTCGTTGCG
TCTGACGGCACCGTCCAGGCGCTTTGGCTGTCGTATTTGGGCGAGAGATCACCCTGTAGCCAGCGTGATGAGGAG
TACTATCTTGGTCTGGGCACTCCAACGCTGCTGCCCGTAGTGTCGACGGTTCAGCGCGGCGAGACGCCGCAGCTG
CGGATGCTGTCGGTCGAGCTGCGATCGGTGCAAATGGCTCAGGCGCGCGTCATGGGCGTATCAGACGAATGGATC
AAAAAAGTAACCGAGGCCAACCCCTCTCACCATCAGCTCTTCATGGTTAGCAAGAGGACCTTTGAGCGCGGCGAG
CACCCCGTATCTCTGGTCGAGGGCGACATAGTGCTCAAGCTCAACGGCAAGATGTGCACCACTATATCCGATTTT
GATGTCATGTACTCGACGGATGTGCTCGACGCCGTCATTGTTCGCGAATGTGAAGAATTGCACCTACGGTTACCG
ACAGTGGCTGCTAAGGACATGGAGACGGATCGGGCCGTATCTTTTTGTGGTGCTATTCTCCATCGTCCACATCAC
GCTGTGCGTCAACAGATCAGCAAGCTGCACAGCGAGGTGTATGTATCGAGCCGTATTCGGGGTTCTCCAGCATAT
CAGTACGGTGTTGCCCCTACTAACTTTATCACACACGTCAACGGACGGTCAACACCAGATCTTGAGTCGTTTATT
GAGGCTACAAGGCAGATTCCTGACAATACTTATTTTCGGCTCAAGGCTGTTACGTTCGACAGCGTGCCGTGGGTA
ATCACCATGAAGAAGAATGATCACTACTTTCCCACAGTGGAGTGGATCAAAGACAGCAGTGAGGAGTGTGGGTGG
CGGCGCGTTACTTACGAAGGGACCAAGGTGGTTGAGGGCGAATCGACCGAGGGTGTACCGGCCATGGCTGAGGAT
ACCGAAATGGAGTGA
Transcript >OphauG2|5807
ATGAACGGCTCACGGGCTGCAGTCTCGGGCAAGCGACGAGCAGCCTCTTCTCCTTCCTCGGACAACGCGCCACCG
GTTAAGCGAATGCTCAACGGCCGACTGTCTGCCGACGATAACACTCCCGACTGTGGCTATGCCGACTTTGACGAC
AGCTCGGATCTGTCGCATCCAGGCGGGCCGCACGGCCTGGTCCCGCCCATGTATATTGGAACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAATGTGGTTGCCATTCGCTTCTGCCAAACGTACATCATG
ACCAATCGCCACGTTGTCGGCGCCGGCCCCTTCTGGGGTCATTGCGTCTTCGACAATCACGAAGAAGTTGACTGC
CGTCCGGTATACCGCGACCCCGTTCACGATTTCGGAATTTTGCGCTACGACCCCAAAGCTATCAAGTATATGCAC
GTTGACGGCCTTGACCTGAGGCCAGATCTGGCAAAAGGCATGTGGAACCCGCTGTCCTTTGGTGTCGAGATTCGC
GTTGTTGGCAACGACGCCGGCGAGAAGCTCAGTATCCTATCAGGCGTCATCAGTCGCCTCGACCGCAATGCTCCC
GAGTACGGCGAGGGATACAGCGACTTCAATACGTGCTACTACCAGGCCAACGCCGCCGCTAGTGGAGGCAGCTCT
GGCAGCCCCGTCGTCAGCAAGGATGGCTCGGCTGTGGCCCTCCAGGCTGGTGGTCGATGCGACGGACCCTCAACC
GATTACTTCCTTCCCCTGGATCGCCCGCTACGCGCCCTCAAATGCATCCAGCAGGGCAAGCCCGTCACTCGTGGC
GACGTACAGTGCCAGTTCTTGCTCAAGCCCTTTGACGAATGTCGTCGGCTAGGACTCAGTCCTGAGTGGGAGGCT
GCTATGCGCAAGGCGTTTCCAGATGAAACCAACATGCTTGTGGCTGAGATTATTCTGCCCTCTGGTCCTTCGCAT
CTCAAGATTGAAGAAGGCGATGTGCTCATCAAAGTCAATGGAGAACTCATTACCCAGTTTATCAGGTTGGACGAT
ATTCTTGACTCCCATGTAGGCAAGACCATCAAGTTCCAGCTTCAACGCGGTGGCCAGAACGTTGAAGTGGAAATT
CAAGTTGGCGACCTCCATGGCATCACGCCCGATCGCTTCATATCTATTGCTGGCGCCAGCTTCCACAACCTGTCG
TACCAGCAAGCAAGACTCTACGCTGTGGCCGTACAGGGCGTATTCGTTTGCGAATCGGCTGGCTCATTCCGCTTT
GACACCTCGGACCATGGATGGATCATCCACACTGTCGACCACAAAAAGGTGCCAGATTTAGACACCTTTGTCCAG
GTCATGAAGACGATTCCTGACAAGGCCAGAGTCGTGGCGACGTACAAGCATCTGCGTGACCTACATACGCTCAAT
ACATCGGTCCTGTACATTGACCGCCACTGGTCCTCCAAGATGAAGCTGGCGGTGCGAAACGACGAGACGGGCATG
TGGGATTTTACAGATCTGGGAGACGCGCTGCCGCCAGTCTCGCCCGTTCGCCGGTCGGCCTCGTTTATCGAGCTC
GACCATATGCCCCATCCGGGCATTGCGGAGCTGATTCGGAGCTTTGTCCACGTCAACTGCACAATGCCCATGAAA
CTCGACGGTTTCCCTAAGAACAGGCGTTGGGGCATGGGCCTTGTCATTGATGCTGACAAGGGCCTGGTGCTCATC
TCGCGAGCCATTGTGCCATATGACCTTTGCGACATTACTGTCACTATTGCTGATTCCATTTTTGTCGAGGCAAAG
GTTATATTTTTGCACCCGCTACAAAACTACGCCATCATCAAGTACGACCCGTCGCTTGTTGATGCGCCCGTCAGG
AGCGCGAGGATGAGCGACCAGCACCTAGCGCAAGGAGCCAAGACGTATTTTGTCGGCTACAACAGGATTGGTCGC
GTGGTGCACGGCTCGACGACGGTGACGGAAATCACTGCTGTGGCCATACCAGCCAACTCGGGGGCGCCGCGCTAC
CGCGCCGTCAATGTTGACGCCATTACCATTGATAGCAACCTAGGGTCTACTTGCAACAGCGGCGTCCTCGTTGCG
TCTGACGGCACCGTCCAGGCGCTTTGGCTGTCGTATTTGGGCGAGAGATCACCCTGTAGCCAGCGTGATGAGGAG
TACTATCTTGGTCTGGGCACTCCAACGCTGCTGCCCGTAGTGTCGACGGTTCAGCGCGGCGAGACGCCGCAGCTG
CGGATGCTGTCGGTCGAGCTGCGATCGGTGCAAATGGCTCAGGCGCGCGTCATGGGCGTATCAGACGAATGGATC
AAAAAAGTAACCGAGGCCAACCCCTCTCACCATCAGCTCTTCATGGTTAGCAAGAGGACCTTTGAGCGCGGCGAG
CACCCCGTATCTCTGGTCGAGGGCGACATAGTGCTCAAGCTCAACGGCAAGATGTGCACCACTATATCCGATTTT
GATGTCATGTACTCGACGGATGTGCTCGACGCCGTCATTGTTCGCGAATGTGAAGAATTGCACCTACGGTTACCG
ACAGTGGCTGCTAAGGACATGGAGACGGATCGGGCCGTATCTTTTTGTGGTGCTATTCTCCATCGTCCACATCAC
GCTGTGCGTCAACAGATCAGCAAGCTGCACAGCGAGGTGTATGTATCGAGCCGTATTCGGGGTTCTCCAGCATAT
CAGTACGGTGTTGCCCCTACTAACTTTATCACACACGTCAACGGACGGTCAACACCAGATCTTGAGTCGTTTATT
GAGGCTACAAGGCAGATTCCTGACAATACTTATTTTCGGCTCAAGGCTGTTACGTTCGACAGCGTGCCGTGGGTA
ATCACCATGAAGAAGAATGATCACTACTTTCCCACAGTGGAGTGGATCAAAGACAGCAGTGAGGAGTGTGGGTGG
CGGCGCGTTACTTACGAAGGGACCAAGGTGGTTGAGGGCGAATCGACCGAGGGTGTACCGGCCATGGCTGAGGAT
ACCGAAATGGAGTGA
Gene >OphauG2|5807
ATGAACGGCTCACGGGCTGCAGTCTCGGGCAAGCGACGAGCAGCCTCTTCTCCTTCCTCGGACAACGCGCCACCG
GTTAAGCGAATGCTCAACGGCCGACTGTCTGCCGACGATAACACTCCCGACTGTGGCTATGCCGACTTTGACGAC
AGCTCGGATCTGTCGCATCCAGGCGGGCCGCACGGCCTGGTCCCGCCCATGTATATTGGAACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAATGTGGTTGCCATTCGCTTCTGCCAAACGTGTTCCTTT
GATACAGACCCGGCTCTGACCAGTGAGGCCACGGGCTTTGTTGTAGACTCTGAACGAGGGCAAGGCGCCATTTAT
CCATGTCGTCGCAGCCCTGACACATGCTGACATGGCTTCTGGTGCTCAGGTACATCATGACCAATCGCCACGTTG
TCGGCGCCGGCCCCTTCTGGGGTCATTGCGTCTTCGACAATCACGAAGAAGTTGACTGCCGTCCGGTATACCGCG
ACCCCGTTCACGATTTCGGAATTTTGCGCTACGACCCCAAAGCTATCAAGTATATGCACGTTGACGGCCTTGACC
TGAGGCCAGATCTGGCAAAAGGCATGTGGAACCCGCTGTCCTGTGCCCCTTTTATTCATCAAGCAGCTAACTCCA
GTCCAACCAGTTGGTGTCGAGATTCGCGTTGTTGGCAACGACGCCGGCGAGAAGCTCAGTATCCTATCAGGCGTC
ATCAGTCGCCTCGACCGCAATGCTCCCGAGTACGGCGAGGGATACAGCGACTTCAATACGTGCTACTACCAGGCC
AACGCCGCCGCTAGTGGAGGCAGCTCTGGCAGCCCCGTCGTCAGCAAGGATGGCTCGGCTGTGGCCCTCCAGGCT
GGTGGTCGATGCGACGGACCCTCAACCGATTACTTCCTTCCCCTGGATCGCCCGCTACGCGCCCTCAAATGCATC
CAGCAGGGCAAGCCCGTCACTCGTGGCGACGTACAGTGCCAGTTCTTGCTCAAGCCCTTTGACGAATGTCGTCGG
CTAGGACTCAGTCCTGAGTGGGAGGCTGCTATGCGCAAGGCGTTTCCAGATGAAACCAACATGCTTGTGGCTGAG
ATTATTCTGCCCTCTGGTCCTTCGCATCTCAAGATTGAAGAAGGCGATGTGCTCATCAAAGTCAATGGAGAACTC
ATTACCCAGTTTATCAGGTTGGACGATATTCTTGACTCCCATGTAGGCAAGACCATCAAGTTCCAGCTTCAACGC
GGTGGCCAGAACGTTGAAGTGGAAATTCAAGTTGGCGACCTCCATGGCATCACGCCCGATCGCTTCATATCTATT
GCTGGCGCCAGCTTCCACAACCTGTCGTACCAGCAAGCAAGACTCTACGCTGTGGCCGTACAGGGCGTATTCGTT
TGCGAATCGGCTGGCTCATTCCGCTTTGACACCTCGGACCATGGATGGATCATCCACACTGTCGACCACAAAAAG
GTGCCAGATTTAGACACCTTTGTCCAGGTCATGAAGACGATTCCTGACAAGGCCAGAGTCGTGGCGACGTACAAG
CATCTGCGTGACCTACATACGCTCAATACATCGGTCCTGTACATTGACCGCCACTGGTCCTCCAAGATGAAGCTG
GCGGTGCGAAACGACGAGACGGGCATGTGGGATTTTACAGATCTGGGAGACGCGCTGCCGCCAGTCTCGCCCGTT
CGCCGGTCGGCCTCGTTTATCGAGCTCGACCATATGCCCCATCCGGGCATTGCGGAGCTGATTCGGAGCTTTGTC
CACGTCAACTGCACAATGCCCATGAAACTCGACGGTTTCCCTAAGAACAGGCGTTGGGGCATGGGCCTTGTCATT
GATGCTGACAAGGGCCTGGTGCTCATCTCGCGAGCCATTGTGCCATATGACCTTTGCGACATTACTGTCACTATT
GCTGATTCCATTTTTGTCGAGGCAAAGGTTATATTTTTGCACCCGCTACAAAACTACGCCATCATCAAGTACGAC
CCGTCGCTTGTTGATGCGCCCGTCAGGAGCGCGAGGATGAGCGACCAGCACCTAGCGCAAGGAGCCAAGACGTAT
TTTGTCGGCTACAACAGGATTGGTCGCGTGGTGCACGGCTCGACGACGGTGACGGAAATCACTGCTGTGGCCATA
CCAGCCAACTCGGGGGCGCCGCGCTACCGCGCCGTCAATGTTGACGCCATTACCATTGATAGCAACCTAGGGTCT
ACTTGCAACAGCGGCGTCCTCGTTGCGTCTGACGGCACCGTCCAGGCGCTTTGGCTGTCGTATTTGGGCGAGAGA
TCACCCTGTAGCCAGCGTGATGAGGAGTACTATCTTGGTCTGGGCACTCCAACGCTGCTGCCCGTAGTGTCGACG
GTTCAGCGCGGCGAGACGCCGCAGCTGCGGATGCTGTCGGTCGAGCTGCGATCGGTGCAAATGGCTCAGGCGCGC
GTCATGGGCGTATCAGACGAATGGATCAAAAAAGTAACCGAGGCCAACCCCTCTCACCATCAGCTCTTCATGGTT
AGCAAGAGGACCTTTGAGCGCGGCGAGCACCCCGTATCTCTGGTCGAGGGCGACATAGTGCTCAAGCTCAACGGC
AAGATGTGCACCACTATATCCGATTTTGATGTCATGTACTCGACGGATGTGCTCGACGCCGTCATTGTTCGCGAA
TGTGAAGAATTGCACCTACGGTTACCGACAGTGGCTGCTAAGGACATGGAGACGGATCGGGCCGTATCTTTTTGT
GGTGCTATTCTCCATCGTCCACATCACGCTGTGCGTCAACAGATCAGCAAGCTGCACAGCGAGGTGTATGTATCG
AGCCGTATTCGGGGTTCTCCAGCATATCAGTACGGTGTTGCCCCTACTAACTTTATCACACACGTCAACGGACGG
TCAACACCAGATCTTGAGTCGTTTATTGAGGCTACAAGGCAGATTCCTGACAATACTTGTAAGTGTTCCAGCTTC
GCGCCTCTTGGGGAGAGAGGGGGAGAGAGGATCGAGATTGCTGACCAAAGGCGTGGTGTCAAAGATTTTCGGCTC
AAGGCTGTTACGTTCGACAGCGTGCCGTGGGTAATCACCATGAAGAAGAATGATCACTACTTTCCCACAGTGGAG
TGGATCAAAGACAGCAGTGAGGAGTGTGGGTGGCGGCGCGTTACTTACGAAGGGACCAAGGTGGTTGAGGGCGAA
TCGACCGAGGGTGTACCGGCCATGGCTGAGGATACCGAAATGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail