Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5766
Gene name
LocationContig_55:27780..28883
Strand+
Gene length (bp)1103
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 6.0E-18 2 136
PF00581 Rhodanese Rhodanese-like domain 2.5E-08 242 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 1 343 2.0E-113
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 3 341 8.0E-99
sp|A7F582|UBA4_SCLS1 Adenylyltransferase and sulfurtransferase uba4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=uba4 PE=3 SV=1 31 341 2.0E-98
sp|Q0CFD4|UBA4_ASPTN Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=uba4 PE=3 SV=1 3 341 7.0E-95
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 3 341 3.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 1 343 2.0E-113
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 3 341 8.0E-99
sp|A7F582|UBA4_SCLS1 Adenylyltransferase and sulfurtransferase uba4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=uba4 PE=3 SV=1 31 341 2.0E-98
sp|Q0CFD4|UBA4_ASPTN Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=uba4 PE=3 SV=1 3 341 7.0E-95
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 3 341 3.0E-94
sp|A1CAZ7|UBA4_ASPCL Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=uba4 PE=3 SV=1 3 341 4.0E-93
sp|Q2TWN3|UBA4_ASPOR Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=uba4 PE=3 SV=1 3 341 3.0E-92
sp|Q4WV19|UBA4_ASPFU Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=uba4 PE=3 SV=1 3 341 3.0E-89
sp|B0Y0P7|UBA4_ASPFC Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=uba4 PE=3 SV=1 3 341 3.0E-89
sp|A1DED8|UBA4_NEOFI Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=uba4 PE=3 SV=1 3 341 1.0E-80
sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 1 342 1.0E-79
sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 1 342 7.0E-79
sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 1 342 8.0E-79
sp|A5DMB6|UBA4_PICGU Adenylyltransferase and sulfurtransferase UBA4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UBA4 PE=3 SV=1 3 342 4.0E-74
sp|Q6CBK1|UBA4_YARLI Adenylyltransferase and sulfurtransferase UBA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBA4 PE=3 SV=1 3 342 2.0E-72
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 1 342 8.0E-72
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 1 342 8.0E-72
sp|A3LQF9|UBA4_PICST Adenylyltransferase and sulfurtransferase UBA4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UBA4 PE=3 SV=2 1 341 1.0E-69
sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 1 342 2.0E-69
sp|Q59WH7|UBA4_CANAL Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1 3 341 2.0E-69
sp|A5DSR2|UBA4_LODEL Adenylyltransferase and sulfurtransferase UBA4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UBA4 PE=3 SV=1 3 341 4.0E-69
sp|B4HYP0|MOCS3_DROSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila sechellia GN=GM17034 PE=3 SV=1 1 342 6.0E-69
sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 1 342 2.0E-68
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 1 342 3.0E-68
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 1 342 3.0E-68
sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 1 342 4.0E-68
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 1 342 5.0E-68
sp|B3MLX7|MOCS3_DROAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila ananassae GN=GF15533 PE=3 SV=1 1 342 6.0E-68
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 1 342 8.0E-68
sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 1 341 4.0E-66
sp|Q6BHZ2|UBA4_DEBHA Adenylyltransferase and sulfurtransferase UBA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBA4 PE=3 SV=1 1 341 6.0E-66
sp|A1A4L8|MOCS3_BOVIN Adenylyltransferase and sulfurtransferase MOCS3 OS=Bos taurus GN=MOCS3 PE=2 SV=2 2 341 7.0E-64
sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 3 341 1.0E-62
sp|P38820|UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1 1 341 3.0E-62
sp|B3LSM6|UBA4_YEAS1 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UBA4 PE=3 SV=1 1 341 3.0E-62
sp|B5VK45|UBA4_YEAS6 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UBA4 PE=3 SV=1 1 341 3.0E-62
sp|A6ZT19|UBA4_YEAS7 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain YJM789) GN=UBA4 PE=3 SV=1 1 341 5.0E-62
sp|Q09810|UBA4_SCHPO Adenylyltransferase and sulfurtransferase uba4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba4 PE=3 SV=1 1 342 8.0E-62
sp|Q6CMC2|UBA4_KLULA Adenylyltransferase and sulfurtransferase UBA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBA4 PE=3 SV=1 1 341 2.0E-61
sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 3 341 2.0E-57
sp|A7THV5|UBA4_VANPO Adenylyltransferase and sulfurtransferase UBA4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UBA4 PE=3 SV=1 1 341 4.0E-57
sp|B4FAT0|MOC32_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Zea mays GN=MOCS3-2 PE=2 SV=1 2 341 9.0E-57
sp|Q55FS0|UBA4_DICDI Adenylyltransferase and sulfurtransferase MOCS3 OS=Dictyostelium discoideum GN=mocs3 PE=3 SV=1 1 342 1.0E-56
sp|Q6FR35|UBA4_CANGA Adenylyltransferase and sulfurtransferase UBA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBA4 PE=3 SV=1 1 341 7.0E-56
sp|Q756K6|UBA4_ASHGO Adenylyltransferase and sulfurtransferase UBA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBA4 PE=3 SV=1 6 341 1.0E-55
sp|A8WRE3|MOCS3_CAEBR Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis briggsae GN=uba-4 PE=3 SV=3 11 342 3.0E-55
sp|B6TNK6|MOC31_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Zea mays GN=MOCS3-1 PE=2 SV=1 2 341 1.0E-54
sp|A2BDX3|MOCS3_MOUSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Mus musculus GN=Mocs3 PE=1 SV=1 32 341 2.0E-54
sp|A5GFZ6|MOCS3_PIG Adenylyltransferase and sulfurtransferase MOCS3 OS=Sus scrofa GN=MOCS3 PE=3 SV=1 2 341 5.0E-54
sp|O44510|MOCS3_CAEEL Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis elegans GN=moc-3 PE=3 SV=2 2 342 7.0E-54
sp|O95396|MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens GN=MOCS3 PE=1 SV=1 2 341 5.0E-53
sp|A3ACF3|MOCS3_ORYSJ Adenylyltransferase and sulfurtransferase MOCS3 OS=Oryza sativa subsp. japonica GN=MOCS3 PE=3 SV=1 31 340 1.0E-42
sp|Q1XDF1|MOEB_PYRYE Probable molybdopterin-synthase adenylyltransferase OS=Pyropia yezoensis GN=moeB PE=3 SV=1 2 340 2.0E-25
sp|P9WMN7|MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeZ PE=1 SV=1 2 340 2.0E-23
sp|P9WMN6|MOEZ_MYCTO Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeZ PE=3 SV=1 2 340 2.0E-23
sp|D4GSF3|UBAA_HALVD SAMP-activating enzyme E1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=ubaA PE=1 SV=1 3 217 5.0E-23
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 3 143 4.0E-22
sp|Q56067|MOEB_SALTY Molybdopterin-synthase adenylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeB PE=3 SV=2 3 133 2.0E-19
sp|P51335|MOEB_PORPU Probable molybdopterin-synthase adenylyltransferase OS=Porphyra purpurea GN=moeB PE=3 SV=1 1 336 4.0E-19
sp|P45211|MOEB_HAEIN Molybdopterin-synthase adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeB PE=3 SV=1 1 142 2.0E-18
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 11 133 9.0E-18
sp|P18500|HESA_NOSS1 Protein HesA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hesA PE=3 SV=2 3 132 2.0E-11
sp|P46049|HESA1_ANAVT Protein HesA, heterocyst OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesA1 PE=2 SV=2 3 132 3.0E-11
sp|P46048|HESA2_ANAVT Protein HesA, vegetative OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesA2 PE=2 SV=1 3 132 3.0E-11
sp|Q6B908|MOEB_GRATL Probable molybdopterin-synthase adenylyltransferase OS=Gracilaria tenuistipitata var. liui GN=moeB PE=3 SV=1 11 137 3.0E-11
sp|P46037|HESA_LEPBY Protein HesA OS=Leptolyngbya boryana GN=hesA PE=3 SV=1 3 133 5.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5766
MSKVLSAITYLKQLNPRVVYTPHHERLSPCNAASIVSKYDIVLDCTDHPAVRYLISDTCVLLGRPLVSASAFQTS
GQLVVLNCPPGQGPCYRCVFPRPPPPESVVGCGEGGILGPVVGVMGVLQALETVRLIARGLGYDACGEQGDKAED
KAGDKAGQNEASQVTMMLLSATGHQTTFRSVRMRGRRPGCFACAESSRLSLDTLASSMDYVEFCGTAKPVSLLQP
NERISVQKYAALVSSPDSPRHIVLDVREKEHFSLGSLPGAINLPMSQISRGHDFSRLIPPQQLHMPIYVVCRMGN
DSQLVVRKLKQRQMDNGNEPCVRDIMGGVRAWKEAVDPTLPFV*
Coding >OphauG2|5766
ATGAGCAAGGTGCTCAGCGCAATCACATATCTGAAGCAACTCAACCCGCGCGTTGTATACACGCCGCATCACGAG
CGTCTCTCGCCATGCAATGCCGCCTCCATCGTCTCCAAGTACGACATTGTCCTCGACTGTACAGACCATCCCGCT
GTGCGTTATCTCATTTCCGATACATGTGTCCTGTTGGGCCGGCCGTTGGTTTCGGCATCAGCCTTTCAGACATCG
GGTCAGCTCGTTGTTTTGAATTGTCCGCCGGGACAGGGTCCCTGCTACAGATGTGTCTTCCCGCGGCCGCCACCG
CCTGAGAGCGTCGTGGGCTGTGGCGAGGGCGGGATTCTGGGGCCGGTGGTGGGCGTCATGGGCGTCTTGCAGGCG
CTAGAAACAGTGCGGCTCATTGCGCGTGGCCTGGGATACGATGCCTGCGGCGAACAAGGGGACAAGGCAGAGGAC
AAGGCAGGGGACAAGGCAGGACAGAATGAAGCGAGCCAAGTCACCATGATGCTGCTATCCGCGACAGGCCACCAG
ACCACCTTTCGATCGGTTCGCATGCGTGGCCGACGCCCCGGCTGCTTTGCCTGCGCCGAATCGTCTCGTCTTTCC
CTCGACACGCTGGCGTCGTCCATGGACTATGTCGAGTTCTGCGGCACTGCCAAGCCAGTCTCCCTCCTCCAGCCC
AACGAGCGTATCTCTGTGCAAAAGTACGCCGCCCTCGTCTCCTCGCCCGACTCACCACGCCACATTGTGCTCGAC
GTTAGGGAAAAGGAACACTTTAGCCTCGGCAGCCTGCCTGGCGCAATCAACCTGCCCATGAGCCAAATCAGCCGC
GGCCACGACTTTTCCCGCCTTATTCCGCCCCAGCAGCTACACATGCCAATCTATGTCGTGTGTCGCATGGGCAAC
GACTCGCAACTCGTTGTGCGCAAACTGAAGCAGCGACAAATGGACAACGGCAACGAGCCCTGTGTCCGAGACATC
ATGGGCGGGGTCAGGGCGTGGAAAGAAGCTGTGGATCCTACTCTGCCATTCGTCTAG
Transcript >OphauG2|5766
ATGAGCAAGGTGCTCAGCGCAATCACATATCTGAAGCAACTCAACCCGCGCGTTGTATACACGCCGCATCACGAG
CGTCTCTCGCCATGCAATGCCGCCTCCATCGTCTCCAAGTACGACATTGTCCTCGACTGTACAGACCATCCCGCT
GTGCGTTATCTCATTTCCGATACATGTGTCCTGTTGGGCCGGCCGTTGGTTTCGGCATCAGCCTTTCAGACATCG
GGTCAGCTCGTTGTTTTGAATTGTCCGCCGGGACAGGGTCCCTGCTACAGATGTGTCTTCCCGCGGCCGCCACCG
CCTGAGAGCGTCGTGGGCTGTGGCGAGGGCGGGATTCTGGGGCCGGTGGTGGGCGTCATGGGCGTCTTGCAGGCG
CTAGAAACAGTGCGGCTCATTGCGCGTGGCCTGGGATACGATGCCTGCGGCGAACAAGGGGACAAGGCAGAGGAC
AAGGCAGGGGACAAGGCAGGACAGAATGAAGCGAGCCAAGTCACCATGATGCTGCTATCCGCGACAGGCCACCAG
ACCACCTTTCGATCGGTTCGCATGCGTGGCCGACGCCCCGGCTGCTTTGCCTGCGCCGAATCGTCTCGTCTTTCC
CTCGACACGCTGGCGTCGTCCATGGACTATGTCGAGTTCTGCGGCACTGCCAAGCCAGTCTCCCTCCTCCAGCCC
AACGAGCGTATCTCTGTGCAAAAGTACGCCGCCCTCGTCTCCTCGCCCGACTCACCACGCCACATTGTGCTCGAC
GTTAGGGAAAAGGAACACTTTAGCCTCGGCAGCCTGCCTGGCGCAATCAACCTGCCCATGAGCCAAATCAGCCGC
GGCCACGACTTTTCCCGCCTTATTCCGCCCCAGCAGCTACACATGCCAATCTATGTCGTGTGTCGCATGGGCAAC
GACTCGCAACTCGTTGTGCGCAAACTGAAGCAGCGACAAATGGACAACGGCAACGAGCCCTGTGTCCGAGACATC
ATGGGCGGGGTCAGGGCGTGGAAAGAAGCTGTGGATCCTACTCTGCCATTCGTCTAG
Gene >OphauG2|5766
ATGAGCAAGGTGCTCAGCGCAATCACATATCTGAAGCAGTACGTTTGCATTCGAGGAAGCGTATCCAAGCCTCCA
AAAACTCTGCAAGCTACAAACTCACGCGCTACAGACTCAACCCGCGCGTTGTATACACGCCGCATCACGAGCGTC
TCTCGCCATGCAATGCCGCCTCCATCGTCTCCAAGTACGACATTGTCCTCGACTGTACAGACCATCCCGCTGTGC
GTTATCTCATTTCCGATACATGTGTCCTGTTGGGCCGGCCGTTGGTTTCGGCATCAGCCTTTCAGACATCGGGTC
AGCTCGTTGTTTTGAATTGTCCGCCGGGACAGGGTCCCTGCTACAGATGTGTCTTCCCGCGGCCGCCACCGCCTG
AGAGCGTCGTGGGCTGTGGCGAGGGCGGGATTCTGGGGCCGGTGGTGGGCGTCATGGGCGTCTTGCAGGCGCTAG
AAACAGTGCGGCTCATTGCGCGTGGCCTGGGATACGATGCCTGCGGCGAACAAGGGGACAAGGCAGAGGACAAGG
CAGGGGACAAGGCAGGACAGAATGAAGCGAGCCAAGTCACCATGATGCTGCTATCCGCGACAGGCCACCAGACCA
CCTTTCGATCGGTTCGCATGCGTGGCCGACGCCCCGGCTGCTTTGCCTGCGCCGAATCGTCTCGTCTTTCCCTCG
ACACGCTGGCGTCGTCCATGGACTATGTCGAGTTCTGCGGCACTGCCAAGCCAGTCTCCCTCCTCCAGCCCAACG
AGCGTATCTCTGTGCAAAAGTACGCCGCCCTCGTCTCCTCGCCCGACTCACCACGCCACATTGTGCTCGACGTTA
GGGAAAAGGAACACTTTAGCCTCGGCAGCCTGCCTGGCGCAATCAACCTGCCCATGAGCCAAATCAGCCGCGGCC
ACGACTTTTCCCGCCTTATTCCGCCCCAGCAGCTACACATGCCAATCTATGTCGTGTGTCGCATGGGCAACGACT
CGCAACTCGTTGTGCGCAAACTGAAGCAGCGACAAATGGACAACGGCAACGAGCCCTGTGTCCGAGACATCATGG
GCGGGGTCAGGGCGTGGAAAGAAGCTGTGGATCCTACTCTGCCATTCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail