Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5749
Gene name
LocationContig_548:10321..11911
Strand+
Gene length (bp)1590
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 1.6E-12 252 414

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 235 428 3.0E-16
sp|Q5AL29|REXO3_CANAL RNA exonuclease 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX3 PE=3 SV=1 247 422 8.0E-16
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 243 417 4.0E-15
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 158 416 2.0E-14
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 239 416 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 235 428 3.0E-16
sp|Q5AL29|REXO3_CANAL RNA exonuclease 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX3 PE=3 SV=1 247 422 8.0E-16
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 243 417 4.0E-15
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 158 416 2.0E-14
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 239 416 3.0E-13
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 248 416 4.0E-13
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 216 416 5.0E-13
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 214 416 6.0E-13
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 247 423 6.0E-13
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 250 416 7.0E-13
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 251 430 7.0E-13
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 245 416 2.0E-12
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 250 412 2.0E-12
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 246 406 3.0E-12
sp|Q3U1G5|I20L2_MOUSE Interferon-stimulated 20 kDa exonuclease-like 2 OS=Mus musculus GN=Isg20l2 PE=1 SV=2 239 416 4.0E-12
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 230 425 4.0E-12
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 253 428 1.0E-11
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 251 417 2.0E-11
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 249 416 4.0E-11
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 252 422 6.0E-11
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 242 416 6.0E-11
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 242 416 1.0E-10
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 250 426 2.0E-10
sp|Q4WYA1|REXO3_ASPFU RNA exonuclease 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex3 PE=3 SV=1 249 417 2.0E-10
sp|Q5B367|REXO3_EMENI RNA exonuclease 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rex3 PE=3 SV=2 235 417 3.0E-10
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 239 416 9.0E-10
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 251 430 1.0E-09
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 250 416 2.0E-09
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 252 439 2.0E-09
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 253 419 2.0E-09
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 250 416 3.0E-09
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 252 439 3.0E-09
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 252 440 4.0E-09
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 250 413 1.0E-08
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 253 419 1.0E-08
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 250 416 2.0E-08
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 250 416 2.0E-08
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 249 416 4.0E-08
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 250 416 5.0E-08
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 252 439 5.0E-08
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 250 410 7.0E-08
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 249 416 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5749
MKASSFECGTCHKVFKTKGSLAQHCTAKRHDPARCCWTCRKAFVAAFSFAQHSVDKQHEPARCCWACCKIFKAKK
SLLQHCSAKGHDANPSCPTCKQSFVCRTAQQQHCQSVHGLVRDEQGTMASGATVESGATVESGPLGAMAESITKP
TVTCQHCHRSFGSDSALQQHKDSKHSNPGPESLVYKGNTYTVLDEKEQNVLHFRLQESCHERWRLQKQGFSLSNQ
NKKCKKKATEYEVTPQPIPGVSKRKAIALDCEMAGGRDCQNHLIHLCAIDFFTGETLVHSLVSPSQHIAKWRTRC
HGITKATMEQAIGQNKALDGWKEARDELWKYMDATTIVVGHALHHDLAVLRMKHNQIFDTSIFTSEAVCGRDQRL
RYKYGLDKLCSSLCGIKIRGGEAEESEVHDSKEDALATRELAMWCLQHPDKFGKWAMDELEKHEPGVIEKLRAQH
RRECLDVIRSPDRGWVDYDSSDDSWENDWGDEYVRWQDRRVGDILGSGNEGLREFLGSQDDPMGLLCGRSNESGW
EYLD*
Coding >OphauG2|5749
ATGAAGGCCAGCAGCTTTGAATGTGGCACATGCCACAAGGTGTTCAAGACAAAGGGCAGCCTCGCACAGCATTGC
ACTGCCAAAAGGCACGACCCTGCGCGATGCTGCTGGACCTGCCGCAAGGCGTTTGTAGCAGCCTTTAGTTTTGCA
CAGCACTCGGTTGACAAGCAACATGAGCCTGCGCGATGCTGCTGGGCGTGCTGCAAGATCTTCAAGGCCAAGAAG
AGTCTCTTGCAGCACTGTAGTGCCAAGGGCCACGACGCCAACCCGAGCTGCCCAACGTGCAAGCAATCCTTTGTC
TGTCGGACGGCGCAGCAGCAGCATTGCCAGAGTGTGCACGGTCTGGTACGGGATGAGCAAGGAACAATGGCCTCG
GGCGCAACAGTTGAGTCTGGCGCAACAGTTGAGTCTGGTCCACTCGGGGCAATGGCCGAATCAATCACCAAGCCG
ACTGTTACTTGTCAACACTGTCACCGCTCCTTTGGCAGCGACTCAGCCCTACAGCAGCACAAAGACAGTAAACAC
TCGAACCCAGGCCCGGAATCACTGGTTTACAAGGGAAACACCTACACTGTTCTCGATGAAAAAGAGCAAAATGTA
CTACATTTCCGTCTCCAAGAGAGCTGCCATGAGCGCTGGCGTCTTCAAAAGCAAGGCTTCTCTCTCTCCAACCAG
AATAAAAAGTGCAAGAAGAAAGCGACAGAGTATGAAGTGACACCACAGCCAATACCCGGTGTCTCTAAGCGAAAA
GCAATAGCATTGGATTGCGAGATGGCAGGTGGCAGAGACTGCCAAAACCATCTGATACACCTGTGTGCCATTGAC
TTTTTTACGGGAGAGACGCTTGTTCATTCACTCGTCAGTCCGAGCCAGCACATCGCGAAATGGCGTACCAGGTGC
CACGGCATCACCAAGGCGACCATGGAGCAAGCTATTGGACAGAACAAGGCCTTGGACGGTTGGAAAGAGGCGCGA
GACGAGCTATGGAAGTACATGGATGCAACTACAATTGTCGTGGGACATGCTTTACATCATGACCTTGCGGTGCTT
CGTATGAAGCATAACCAAATTTTCGACACAAGCATCTTCACGTCGGAGGCCGTCTGTGGCAGGGACCAGAGGCTG
CGTTACAAATACGGACTTGATAAATTGTGCAGCAGTCTTTGTGGTATCAAGATTCGAGGCGGCGAGGCGGAGGAG
TCCGAGGTGCACGACAGCAAGGAGGATGCTCTGGCAACGCGCGAGCTGGCCATGTGGTGTCTGCAACACCCTGAT
AAATTCGGGAAGTGGGCAATGGACGAACTCGAGAAGCACGAGCCTGGCGTCATTGAAAAGTTGAGAGCGCAACAC
CGACGAGAGTGCCTTGATGTGATTCGCAGTCCTGACCGCGGATGGGTTGATTACGACTCCTCGGATGACTCGTGG
GAAAACGACTGGGGTGATGAATACGTGAGATGGCAAGACAGGCGTGTCGGGGACATTTTAGGCTCGGGAAACGAA
GGTCTGCGCGAATTTCTCGGCTCGCAAGATGACCCCATGGGTCTGCTTTGCGGAAGGTCAAACGAGAGTGGGTGG
GAATATCTGGACTGA
Transcript >OphauG2|5749
ATGAAGGCCAGCAGCTTTGAATGTGGCACATGCCACAAGGTGTTCAAGACAAAGGGCAGCCTCGCACAGCATTGC
ACTGCCAAAAGGCACGACCCTGCGCGATGCTGCTGGACCTGCCGCAAGGCGTTTGTAGCAGCCTTTAGTTTTGCA
CAGCACTCGGTTGACAAGCAACATGAGCCTGCGCGATGCTGCTGGGCGTGCTGCAAGATCTTCAAGGCCAAGAAG
AGTCTCTTGCAGCACTGTAGTGCCAAGGGCCACGACGCCAACCCGAGCTGCCCAACGTGCAAGCAATCCTTTGTC
TGTCGGACGGCGCAGCAGCAGCATTGCCAGAGTGTGCACGGTCTGGTACGGGATGAGCAAGGAACAATGGCCTCG
GGCGCAACAGTTGAGTCTGGCGCAACAGTTGAGTCTGGTCCACTCGGGGCAATGGCCGAATCAATCACCAAGCCG
ACTGTTACTTGTCAACACTGTCACCGCTCCTTTGGCAGCGACTCAGCCCTACAGCAGCACAAAGACAGTAAACAC
TCGAACCCAGGCCCGGAATCACTGGTTTACAAGGGAAACACCTACACTGTTCTCGATGAAAAAGAGCAAAATGTA
CTACATTTCCGTCTCCAAGAGAGCTGCCATGAGCGCTGGCGTCTTCAAAAGCAAGGCTTCTCTCTCTCCAACCAG
AATAAAAAGTGCAAGAAGAAAGCGACAGAGTATGAAGTGACACCACAGCCAATACCCGGTGTCTCTAAGCGAAAA
GCAATAGCATTGGATTGCGAGATGGCAGGTGGCAGAGACTGCCAAAACCATCTGATACACCTGTGTGCCATTGAC
TTTTTTACGGGAGAGACGCTTGTTCATTCACTCGTCAGTCCGAGCCAGCACATCGCGAAATGGCGTACCAGGTGC
CACGGCATCACCAAGGCGACCATGGAGCAAGCTATTGGACAGAACAAGGCCTTGGACGGTTGGAAAGAGGCGCGA
GACGAGCTATGGAAGTACATGGATGCAACTACAATTGTCGTGGGACATGCTTTACATCATGACCTTGCGGTGCTT
CGTATGAAGCATAACCAAATTTTCGACACAAGCATCTTCACGTCGGAGGCCGTCTGTGGCAGGGACCAGAGGCTG
CGTTACAAATACGGACTTGATAAATTGTGCAGCAGTCTTTGTGGTATCAAGATTCGAGGCGGCGAGGCGGAGGAG
TCCGAGGTGCACGACAGCAAGGAGGATGCTCTGGCAACGCGCGAGCTGGCCATGTGGTGTCTGCAACACCCTGAT
AAATTCGGGAAGTGGGCAATGGACGAACTCGAGAAGCACGAGCCTGGCGTCATTGAAAAGTTGAGAGCGCAACAC
CGACGAGAGTGCCTTGATGTGATTCGCAGTCCTGACCGCGGATGGGTTGATTACGACTCCTCGGATGACTCGTGG
GAAAACGACTGGGGTGATGAATACGTGAGATGGCAAGACAGGCGTGTCGGGGACATTTTAGGCTCGGGAAACGAA
GGTCTGCGCGAATTTCTCGGCTCGCAAGATGACCCCATGGGTCTGCTTTGCGGAAGGTCAAACGAGAGTGGGTGG
GAATATCTGGACTGA
Gene >OphauG2|5749
ATGAAGGCCAGCAGCTTTGAATGTGGCACATGCCACAAGGTGTTCAAGACAAAGGGCAGCCTCGCACAGCATTGC
ACTGCCAAAAGGCACGACCCTGCGCGATGCTGCTGGACCTGCCGCAAGGCGTTTGTAGCAGCCTTTAGTTTTGCA
CAGCACTCGGTTGACAAGCAACATGAGCCTGCGCGATGCTGCTGGGCGTGCTGCAAGATCTTCAAGGCCAAGAAG
AGTCTCTTGCAGCACTGTAGTGCCAAGGGCCACGACGCCAACCCGAGCTGCCCAACGTGCAAGCAATCCTTTGTC
TGTCGGACGGCGCAGCAGCAGCATTGCCAGAGTGTGCACGGTCTGGTACGGGATGAGCAAGGAACAATGGCCTCG
GGCGCAACAGTTGAGTCTGGCGCAACAGTTGAGTCTGGTCCACTCGGGGCAATGGCCGAATCAATCACCAAGCCG
ACTGTTACTTGTCAACACTGTCACCGCTCCTTTGGCAGCGACTCAGCCCTACAGCAGCACAAAGACAGTAAACAC
TCGAACCCAGGCCCGGAATCACTGGTTTACAAGGGAAACACCTACACTGTTCTCGATGAAAAAGAGCAAAATGTA
CTACATTTCCGTCTCCAAGAGAGCTGCCATGAGCGCTGGCGTCTTCAAAAGCAAGGCTTCTCTCTCTCCAACCAG
AATAAAAAGTGCAAGAAGAAAGCGACAGAGTATGAAGTGACACCACAGCCAATACCCGGTGTCTCTAAGCGAAAA
GCAATAGCATTGGATTGCGAGATGGCAGGTGGCAGAGACTGCCAAAACCATCTGATACACCTGTGTGCCATTGAC
TTTTTTACGGGAGAGACGCTTGTTCATTCACTCGTCAGTCCGAGCCAGCACATCGCGAAATGGCGTACCAGGTGC
CACGGCATCACCAAGGCGACCATGGAGCAAGCTATTGGACAGAACAAGGCCTTGGACGGTTGGAAAGAGGCGCGA
GACGAGCTATGGAAGTACATGGATGCAACTACAATTGTCGTGGGACATGCTTTACATCATGACCTTGCGGTGCTT
CGTATGAAGCATAACCAAATTTTCGACACAAGCATCTTCACGTCGGAGGCCGTCTGTGGCAGGGACCAGAGGCTG
CGTTACAAATACGGACTTGATAAATTGTGCAGCAGTCTTTGTGGTATCAAGATTCGAGGCGGCGAGGCGGAGGAG
TCCGAGGTGCACGACAGCAAGGAGGATGCTCTGGCAACGCGCGAGCTGGCCATGTGGTGTCTGCAACACCCTGAT
AAATTCGGGAAGTGGGCAATGGACGAACTCGAGAAGCACGAGCCTGGCGTCATTGAAAAGTTGAGAGCGCAACAC
CGACGAGAGTGCCTTGATGTGATTCGCAGTCCTGACCGCGGATGGGTTGATTACGACTCCTCGGATGACTCGTGG
GAAAACGACTGGGGTGATGAATACGTGAGATGGCAAGACAGGCGTGTCGGGGACATTTTAGGCTCGGGAAACGAA
GGTCTGCGCGAATTTCTCGGCTCGCAAGATGACCCCATGGGTCTGCTTTGCGGAAGGTCAAACGAGAGTGGGTGG
GAATATCTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail