Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5747
Gene name
LocationContig_548:1201..5483
Strand-
Gene length (bp)4282
Transcript length (bp)4233
Coding sequence length (bp)4233
Protein length (aa) 1411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 0.0E+00 6 1346

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1263 2.0E-69
sp|Q04183|TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS120 PE=1 SV=1 469 1363 7.0E-30

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1934
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5747 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8028
Ophiocordyceps camponoti-floridani Ophcf2|05342
Ophiocordyceps camponoti-rufipedis Ophun1|6870
Ophiocordyceps kimflemingae Ophio5|4916
Ophiocordyceps subramaniannii Hirsu2|207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5747
MSQDPLLPIAPARVKALLLPLGKIKADRFALFTERLQTELVVHLRDISADGRPNRNMFSPLAYPDGAMLYHAVTH
MTPPSHLALSPFDLYREPLAVIALADGTELQDSTFSRRHSATSASSMVERNIRALEQDLEDLRDSYPKALVHQVV
IFDYIAPPGGDMTIPEGLVTVPPPDKCKRTTLKTVMCDISSLLLAEMTTLAKSFEGTTSIESPGHYPVPNNANAG
DIGAPAAAPSRRNSQFAMLSLGSRPSSAAENDKHHRMSMPPMASRPPLNSSYSMPARPSTPNRSGLSGTPMSPEE
DQSTLASGTSSPEPKAPRLEADKTLDGSRNRGSMQGFGAGSANDRWRLRGKGRTSIVIGSMYLQAGRWSDSLREL
AEGAAAARSFNDHIWHGKALELILINLLLLGWSNLEFQVPAVCLPPPERPTSILPTIKSEPETADPTQPKHLRNL
KSTLFELLERILGLYSRISSESIPPLPLAETVIRFCKILSAVYLNDGTLNQQAFDMIVLGKVPSGGLSTCPRLSI
TPSRQQIVNMLFRAFPSSTTELITTADRISMLGGIASVLGPLGYRRKKAMVLRELVSVLIGGLVEARTRGAAEAG
IHPASGLVALASPSDGSGGGLALDLGEGDIERGLEGFLELLCKSYGITSFDATSNDSDQAVAKRVIEQSHSRFVG
YLNIKLNILRTCINFAEALPDFNGVLKFSSDLLRTAGSGVAPSSRREDATASIDSNEQMRLVTNISRTAGLVQRI
NMGNLTAEYWDEFLVRSIVLDAPQDARLPVPHSRSILPGANTNRISQEVNPFIYNPFLKEADEAAAQNLAAGEIA
NFRVTLQNTYDVEVDIESIRLCTEGVDFEAMRESVLLGPYRTQILRVRGRPLAPGSIRVTGVIVKVRGCRERRFP
VFANSWMPSPPEKIKTRGVAALQTSLGTGDKGPEVKSLELNVVEAQPLVVVKSTTLPQSSVMILEGERQRFSVTL
ENKSSIAVDMMLFSFKDSTQAPLQEALNKRDATAVELYEYELILAKRQALRLLKSEQARKIAPGEEATFDFEILG
KPGLTKATIQVDYTHLEAVQDNGSEQFYTRQVSLDLTVTVNASVELTRVDALTVYGKIPQPLWERVGGSASTEED
EYCLLCMDLRNAWPSHMTVRIEGQDGLAVEESILPGKTSRVVMPVPRVYLENPYETIPSLNPSRTRQFVVSSGVS
PEMERASREAFWYREKMLENLKASWRTTLAPKRTGAVELRNIRLTSRMIEAIKVDDVGIDVWVEDAGGRRCSGDA
TAQVDEFLKAKVRVSNKGKRPMQVLVRLLPVLCHRASTVSLDYTRKFAWNGTLQQQMTPLEPQDSVDYVLGVTAL
CRGEFELTASVEEVQIWEARGGGRPRSDTQKMRDAALGVRERRMWHSRPCLLTVRDAPRI*
Coding >OphauG2|5747
ATGAGCCAGGACCCGCTGCTGCCTATTGCTCCGGCGCGAGTAAAGGCTCTACTGCTCCCGCTCGGAAAGATCAAG
GCAGACAGGTTTGCCTTGTTTACAGAGCGCCTTCAGACAGAGCTGGTGGTGCATTTGCGCGACATCAGCGCCGAT
GGACGCCCCAACAGAAACATGTTTTCGCCATTGGCGTACCCCGACGGCGCCATGCTATACCATGCCGTTACACAC
ATGACTCCGCCCTCCCATCTCGCTCTCTCGCCATTCGATCTCTATCGTGAGCCCTTGGCCGTCATTGCGCTGGCC
GATGGAACCGAGCTTCAGGACTCCACGTTTAGCAGGCGCCATTCGGCAACATCAGCTTCGTCAATGGTGGAAAGG
AATATCAGGGCGCTCGAACAAGATCTTGAGGACCTTCGTGATAGCTATCCCAAAGCCTTGGTGCACCAGGTGGTC
ATTTTCGACTATATTGCTCCCCCAGGAGGCGACATGACCATTCCTGAGGGATTGGTCACAGTGCCGCCGCCAGAC
AAATGCAAGCGGACAACTCTCAAGACGGTCATGTGCGACATTTCCTCGCTCCTTTTGGCAGAAATGACTACTCTG
GCCAAGTCATTCGAAGGCACTACCTCCATCGAATCTCCGGGACACTATCCGGTCCCCAATAATGCAAATGCTGGT
GACATTGGAGCTCCTGCCGCTGCTCCAAGCCGAAGGAATTCACAGTTTGCCATGCTGAGTCTCGGCTCGCGTCCC
AGCTCGGCCGCCGAGAATGACAAGCACCACCGCATGTCGATGCCGCCAATGGCGTCGAGACCGCCCCTGAATTCG
AGTTACTCGATGCCCGCCAGGCCCTCAACCCCCAACAGAAGTGGGCTTTCAGGAACACCCATGAGCCCTGAAGAA
GATCAAAGCACTCTGGCCAGTGGAACGTCTAGTCCCGAGCCAAAAGCTCCGAGATTAGAGGCAGATAAGACACTT
GATGGCAGCCGGAACCGGGGCTCAATGCAAGGATTTGGAGCTGGAAGCGCCAACGATCGCTGGCGACTCAGAGGA
AAAGGGCGCACGTCAATTGTCATTGGCTCCATGTACTTACAGGCTGGTCGGTGGAGTGACTCGCTCAGGGAGCTA
GCCGAGGGCGCGGCTGCAGCTCGATCTTTCAACGATCACATCTGGCATGGAAAGGCCCTTGAGCTGATTTTAATC
AACCTTCTCCTTTTGGGATGGTCAAACCTGGAGTTTCAGGTACCGGCTGTCTGTTTACCTCCCCCGGAGCGACCC
ACTAGTATACTGCCAACAATCAAGTCTGAGCCAGAGACTGCCGACCCCACACAGCCCAAGCATCTACGAAATTTA
AAGAGCACCTTGTTTGAGTTGCTGGAACGCATACTCGGGCTTTATTCCAGAATATCATCTGAGAGTATTCCGCCA
TTGCCCCTCGCAGAAACTGTTATTAGGTTCTGTAAAATTCTCTCGGCCGTCTATCTGAATGACGGCACGCTCAAC
CAGCAGGCATTTGACATGATTGTCTTGGGCAAAGTCCCATCTGGTGGGCTGAGCACTTGCCCACGCTTGAGTATT
ACTCCTTCAAGACAGCAGATTGTCAACATGCTATTTAGAGCATTTCCTTCATCTACCACGGAGCTCATTACCACT
GCTGATCGAATCTCAATGCTGGGCGGTATAGCATCAGTGCTCGGCCCCTTGGGATATCGACGAAAGAAGGCCATG
GTTCTTCGAGAACTTGTATCAGTTCTTATTGGTGGCCTAGTCGAGGCCCGTACACGTGGGGCTGCTGAAGCCGGC
ATCCACCCTGCCTCTGGCCTGGTGGCACTGGCTTCCCCTAGCGATGGGAGCGGCGGCGGACTGGCCCTCGATCTA
GGCGAAGGGGATATTGAAAGGGGGCTTGAAGGCTTTTTGGAGTTGCTGTGCAAGTCGTACGGCATCACTAGTTTT
GATGCCACGTCCAATGACTCGGATCAAGCCGTCGCCAAGAGAGTTATTGAGCAATCTCATTCGAGATTTGTCGGT
TACCTCAACATCAAGCTCAACATTCTTCGAACCTGCATCAATTTTGCCGAAGCGCTACCAGACTTCAATGGAGTA
CTCAAATTCTCGAGCGATTTGTTGCGGACAGCAGGATCGGGAGTGGCGCCTAGTTCGCGTAGAGAAGATGCAACG
GCTTCGATTGACTCGAATGAGCAGATGCGCCTGGTGACCAATATTTCTCGGACAGCGGGCCTTGTTCAGAGAATC
AACATGGGAAACCTCACGGCAGAATATTGGGATGAATTTCTTGTCAGAAGTATAGTTCTAGATGCGCCGCAAGAT
GCACGACTGCCTGTACCGCACTCACGCAGTATATTGCCTGGCGCAAACACGAATCGGATTTCACAAGAGGTCAAT
CCCTTCATCTACAATCCCTTTCTCAAAGAGGCGGACGAAGCAGCTGCTCAGAATCTTGCAGCCGGCGAGATTGCC
AACTTTCGAGTGACGCTGCAAAACACATATGACGTTGAAGTGGACATTGAAAGCATTCGTTTGTGCACCGAGGGC
GTTGATTTTGAAGCAATGAGGGAAAGTGTGCTGCTCGGACCCTATCGAACTCAGATTCTGCGTGTGCGAGGACGC
CCATTGGCCCCAGGCTCCATCAGAGTCACAGGTGTTATAGTCAAGGTGCGTGGCTGCAGAGAAAGACGGTTTCCC
GTATTTGCCAACTCGTGGATGCCGTCTCCGCCAGAAAAGATCAAGACGAGGGGCGTGGCGGCGCTTCAAACCAGT
CTGGGCACGGGTGACAAAGGGCCCGAGGTCAAGTCACTGGAGCTCAATGTTGTTGAGGCCCAGCCACTTGTGGTT
GTCAAGTCGACAACTCTTCCACAATCCTCAGTTATGATCTTGGAGGGGGAGAGGCAGCGCTTTTCAGTTACTTTG
GAAAACAAGTCAAGCATCGCAGTCGACATGATGCTCTTTTCATTCAAAGACTCGACACAGGCGCCTCTTCAGGAG
GCCCTCAACAAGCGAGACGCCACAGCGGTGGAGCTGTACGAATACGAGCTGATTCTTGCAAAGAGGCAAGCATTG
AGGCTGCTAAAGAGTGAGCAGGCTCGCAAAATAGCGCCTGGCGAGGAGGCGACGTTTGACTTTGAGATTCTTGGC
AAGCCTGGCCTAACAAAGGCAACCATTCAAGTCGACTACACGCATCTTGAAGCTGTTCAAGACAATGGTTCGGAA
CAATTTTATACTCGACAAGTGTCACTAGACTTGACGGTCACGGTCAATGCCAGTGTGGAACTGACACGGGTAGAC
GCATTGACCGTGTACGGCAAGATACCGCAGCCCCTATGGGAGAGGGTTGGCGGCAGCGCGTCAACCGAGGAGGAC
GAGTACTGCTTGCTTTGCATGGACTTGCGCAACGCTTGGCCTAGCCACATGACTGTGCGTATAGAAGGGCAAGAT
GGTCTGGCAGTGGAGGAGAGCATCTTGCCAGGCAAGACCAGCCGGGTGGTTATGCCAGTGCCAAGGGTCTACTTG
GAGAATCCCTACGAGACAATACCAAGTTTGAATCCATCTCGGACTCGCCAGTTTGTGGTTAGCAGTGGGGTGTCG
CCTGAAATGGAAAGGGCCAGTCGAGAGGCGTTTTGGTACCGAGAAAAGATGCTGGAGAATCTCAAGGCATCGTGG
CGGACGACGCTGGCGCCAAAACGGACGGGGGCTGTAGAGCTGCGCAACATTCGCCTGACGTCGCGCATGATTGAG
GCGATCAAGGTGGACGACGTGGGCATTGACGTGTGGGTCGAGGACGCAGGTGGACGGCGATGCAGCGGCGACGCG
ACGGCGCAGGTGGATGAATTTCTCAAGGCCAAAGTGCGCGTCAGCAACAAGGGCAAGAGGCCCATGCAGGTGCTG
GTGAGACTGCTGCCAGTCTTGTGCCATCGAGCGAGCACGGTGTCGCTGGACTACACGCGCAAGTTTGCGTGGAAT
GGAACGTTGCAGCAGCAGATGACGCCTCTGGAGCCGCAAGACAGTGTCGACTATGTGCTGGGAGTCACGGCGCTG
TGCAGGGGGGAGTTTGAGCTGACGGCGTCGGTTGAGGAGGTGCAGATCTGGGAGGCTCGAGGCGGCGGACGGCCG
CGGTCAGATACCCAAAAGATGAGGGATGCGGCGCTGGGAGTCAGGGAGCGACGCATGTGGCATTCACGGCCGTGC
CTGTTGACGGTGAGGGACGCGCCTCGCATATAG
Transcript >OphauG2|5747
ATGAGCCAGGACCCGCTGCTGCCTATTGCTCCGGCGCGAGTAAAGGCTCTACTGCTCCCGCTCGGAAAGATCAAG
GCAGACAGGTTTGCCTTGTTTACAGAGCGCCTTCAGACAGAGCTGGTGGTGCATTTGCGCGACATCAGCGCCGAT
GGACGCCCCAACAGAAACATGTTTTCGCCATTGGCGTACCCCGACGGCGCCATGCTATACCATGCCGTTACACAC
ATGACTCCGCCCTCCCATCTCGCTCTCTCGCCATTCGATCTCTATCGTGAGCCCTTGGCCGTCATTGCGCTGGCC
GATGGAACCGAGCTTCAGGACTCCACGTTTAGCAGGCGCCATTCGGCAACATCAGCTTCGTCAATGGTGGAAAGG
AATATCAGGGCGCTCGAACAAGATCTTGAGGACCTTCGTGATAGCTATCCCAAAGCCTTGGTGCACCAGGTGGTC
ATTTTCGACTATATTGCTCCCCCAGGAGGCGACATGACCATTCCTGAGGGATTGGTCACAGTGCCGCCGCCAGAC
AAATGCAAGCGGACAACTCTCAAGACGGTCATGTGCGACATTTCCTCGCTCCTTTTGGCAGAAATGACTACTCTG
GCCAAGTCATTCGAAGGCACTACCTCCATCGAATCTCCGGGACACTATCCGGTCCCCAATAATGCAAATGCTGGT
GACATTGGAGCTCCTGCCGCTGCTCCAAGCCGAAGGAATTCACAGTTTGCCATGCTGAGTCTCGGCTCGCGTCCC
AGCTCGGCCGCCGAGAATGACAAGCACCACCGCATGTCGATGCCGCCAATGGCGTCGAGACCGCCCCTGAATTCG
AGTTACTCGATGCCCGCCAGGCCCTCAACCCCCAACAGAAGTGGGCTTTCAGGAACACCCATGAGCCCTGAAGAA
GATCAAAGCACTCTGGCCAGTGGAACGTCTAGTCCCGAGCCAAAAGCTCCGAGATTAGAGGCAGATAAGACACTT
GATGGCAGCCGGAACCGGGGCTCAATGCAAGGATTTGGAGCTGGAAGCGCCAACGATCGCTGGCGACTCAGAGGA
AAAGGGCGCACGTCAATTGTCATTGGCTCCATGTACTTACAGGCTGGTCGGTGGAGTGACTCGCTCAGGGAGCTA
GCCGAGGGCGCGGCTGCAGCTCGATCTTTCAACGATCACATCTGGCATGGAAAGGCCCTTGAGCTGATTTTAATC
AACCTTCTCCTTTTGGGATGGTCAAACCTGGAGTTTCAGGTACCGGCTGTCTGTTTACCTCCCCCGGAGCGACCC
ACTAGTATACTGCCAACAATCAAGTCTGAGCCAGAGACTGCCGACCCCACACAGCCCAAGCATCTACGAAATTTA
AAGAGCACCTTGTTTGAGTTGCTGGAACGCATACTCGGGCTTTATTCCAGAATATCATCTGAGAGTATTCCGCCA
TTGCCCCTCGCAGAAACTGTTATTAGGTTCTGTAAAATTCTCTCGGCCGTCTATCTGAATGACGGCACGCTCAAC
CAGCAGGCATTTGACATGATTGTCTTGGGCAAAGTCCCATCTGGTGGGCTGAGCACTTGCCCACGCTTGAGTATT
ACTCCTTCAAGACAGCAGATTGTCAACATGCTATTTAGAGCATTTCCTTCATCTACCACGGAGCTCATTACCACT
GCTGATCGAATCTCAATGCTGGGCGGTATAGCATCAGTGCTCGGCCCCTTGGGATATCGACGAAAGAAGGCCATG
GTTCTTCGAGAACTTGTATCAGTTCTTATTGGTGGCCTAGTCGAGGCCCGTACACGTGGGGCTGCTGAAGCCGGC
ATCCACCCTGCCTCTGGCCTGGTGGCACTGGCTTCCCCTAGCGATGGGAGCGGCGGCGGACTGGCCCTCGATCTA
GGCGAAGGGGATATTGAAAGGGGGCTTGAAGGCTTTTTGGAGTTGCTGTGCAAGTCGTACGGCATCACTAGTTTT
GATGCCACGTCCAATGACTCGGATCAAGCCGTCGCCAAGAGAGTTATTGAGCAATCTCATTCGAGATTTGTCGGT
TACCTCAACATCAAGCTCAACATTCTTCGAACCTGCATCAATTTTGCCGAAGCGCTACCAGACTTCAATGGAGTA
CTCAAATTCTCGAGCGATTTGTTGCGGACAGCAGGATCGGGAGTGGCGCCTAGTTCGCGTAGAGAAGATGCAACG
GCTTCGATTGACTCGAATGAGCAGATGCGCCTGGTGACCAATATTTCTCGGACAGCGGGCCTTGTTCAGAGAATC
AACATGGGAAACCTCACGGCAGAATATTGGGATGAATTTCTTGTCAGAAGTATAGTTCTAGATGCGCCGCAAGAT
GCACGACTGCCTGTACCGCACTCACGCAGTATATTGCCTGGCGCAAACACGAATCGGATTTCACAAGAGGTCAAT
CCCTTCATCTACAATCCCTTTCTCAAAGAGGCGGACGAAGCAGCTGCTCAGAATCTTGCAGCCGGCGAGATTGCC
AACTTTCGAGTGACGCTGCAAAACACATATGACGTTGAAGTGGACATTGAAAGCATTCGTTTGTGCACCGAGGGC
GTTGATTTTGAAGCAATGAGGGAAAGTGTGCTGCTCGGACCCTATCGAACTCAGATTCTGCGTGTGCGAGGACGC
CCATTGGCCCCAGGCTCCATCAGAGTCACAGGTGTTATAGTCAAGGTGCGTGGCTGCAGAGAAAGACGGTTTCCC
GTATTTGCCAACTCGTGGATGCCGTCTCCGCCAGAAAAGATCAAGACGAGGGGCGTGGCGGCGCTTCAAACCAGT
CTGGGCACGGGTGACAAAGGGCCCGAGGTCAAGTCACTGGAGCTCAATGTTGTTGAGGCCCAGCCACTTGTGGTT
GTCAAGTCGACAACTCTTCCACAATCCTCAGTTATGATCTTGGAGGGGGAGAGGCAGCGCTTTTCAGTTACTTTG
GAAAACAAGTCAAGCATCGCAGTCGACATGATGCTCTTTTCATTCAAAGACTCGACACAGGCGCCTCTTCAGGAG
GCCCTCAACAAGCGAGACGCCACAGCGGTGGAGCTGTACGAATACGAGCTGATTCTTGCAAAGAGGCAAGCATTG
AGGCTGCTAAAGAGTGAGCAGGCTCGCAAAATAGCGCCTGGCGAGGAGGCGACGTTTGACTTTGAGATTCTTGGC
AAGCCTGGCCTAACAAAGGCAACCATTCAAGTCGACTACACGCATCTTGAAGCTGTTCAAGACAATGGTTCGGAA
CAATTTTATACTCGACAAGTGTCACTAGACTTGACGGTCACGGTCAATGCCAGTGTGGAACTGACACGGGTAGAC
GCATTGACCGTGTACGGCAAGATACCGCAGCCCCTATGGGAGAGGGTTGGCGGCAGCGCGTCAACCGAGGAGGAC
GAGTACTGCTTGCTTTGCATGGACTTGCGCAACGCTTGGCCTAGCCACATGACTGTGCGTATAGAAGGGCAAGAT
GGTCTGGCAGTGGAGGAGAGCATCTTGCCAGGCAAGACCAGCCGGGTGGTTATGCCAGTGCCAAGGGTCTACTTG
GAGAATCCCTACGAGACAATACCAAGTTTGAATCCATCTCGGACTCGCCAGTTTGTGGTTAGCAGTGGGGTGTCG
CCTGAAATGGAAAGGGCCAGTCGAGAGGCGTTTTGGTACCGAGAAAAGATGCTGGAGAATCTCAAGGCATCGTGG
CGGACGACGCTGGCGCCAAAACGGACGGGGGCTGTAGAGCTGCGCAACATTCGCCTGACGTCGCGCATGATTGAG
GCGATCAAGGTGGACGACGTGGGCATTGACGTGTGGGTCGAGGACGCAGGTGGACGGCGATGCAGCGGCGACGCG
ACGGCGCAGGTGGATGAATTTCTCAAGGCCAAAGTGCGCGTCAGCAACAAGGGCAAGAGGCCCATGCAGGTGCTG
GTGAGACTGCTGCCAGTCTTGTGCCATCGAGCGAGCACGGTGTCGCTGGACTACACGCGCAAGTTTGCGTGGAAT
GGAACGTTGCAGCAGCAGATGACGCCTCTGGAGCCGCAAGACAGTGTCGACTATGTGCTGGGAGTCACGGCGCTG
TGCAGGGGGGAGTTTGAGCTGACGGCGTCGGTTGAGGAGGTGCAGATCTGGGAGGCTCGAGGCGGCGGACGGCCG
CGGTCAGATACCCAAAAGATGAGGGATGCGGCGCTGGGAGTCAGGGAGCGACGCATGTGGCATTCACGGCCGTGC
CTGTTGACGGTGAGGGACGCGCCTCGCATATAG
Gene >OphauG2|5747
ATGAGCCAGGACCCGCTGCTGCCTATTGCTCCGGCGCGAGTAAAGGCTCTACTGCTCCCGCTCGGAAAGATCAAG
GCAGACAGGTTTGCCTTGTTTACAGAGCGCCTTCAGACAGAGCTGGTGGTGCATTTGCGCGACATCAGCGCCGAT
GGACGCCCCAACAGAAGTAGGCCCATCCAAGGCCAGAAGCTGAGATGCGCTAACCGCCGACGCAGACATGTTTTC
GCCATTGGCGTACCCCGACGGCGCCATGCTATACCATGCCGTTACACACATGACTCCGCCCTCCCATCTCGCTCT
CTCGCCATTCGATCTCTATCGTGAGCCCTTGGCCGTCATTGCGCTGGCCGATGGAACCGAGCTTCAGGACTCCAC
GTTTAGCAGGCGCCATTCGGCAACATCAGCTTCGTCAATGGTGGAAAGGAATATCAGGGCGCTCGAACAAGATCT
TGAGGACCTTCGTGATAGCTATCCCAAAGCCTTGGTGCACCAGGTGGTCATTTTCGACTATATTGCTCCCCCAGG
AGGCGACATGACCATTCCTGAGGGATTGGTCACAGTGCCGCCGCCAGACAAATGCAAGCGGACAACTCTCAAGAC
GGTCATGTGCGACATTTCCTCGCTCCTTTTGGCAGAAATGACTACTCTGGCCAAGTCATTCGAAGGCACTACCTC
CATCGAATCTCCGGGACACTATCCGGTCCCCAATAATGCAAATGCTGGTGACATTGGAGCTCCTGCCGCTGCTCC
AAGCCGAAGGAATTCACAGTTTGCCATGCTGAGTCTCGGCTCGCGTCCCAGCTCGGCCGCCGAGAATGACAAGCA
CCACCGCATGTCGATGCCGCCAATGGCGTCGAGACCGCCCCTGAATTCGAGTTACTCGATGCCCGCCAGGCCCTC
AACCCCCAACAGAAGTGGGCTTTCAGGAACACCCATGAGCCCTGAAGAAGATCAAAGCACTCTGGCCAGTGGAAC
GTCTAGTCCCGAGCCAAAAGCTCCGAGATTAGAGGCAGATAAGACACTTGATGGCAGCCGGAACCGGGGCTCAAT
GCAAGGATTTGGAGCTGGAAGCGCCAACGATCGCTGGCGACTCAGAGGAAAAGGGCGCACGTCAATTGTCATTGG
CTCCATGTACTTACAGGCTGGTCGGTGGAGTGACTCGCTCAGGGAGCTAGCCGAGGGCGCGGCTGCAGCTCGATC
TTTCAACGATCACATCTGGCATGGAAAGGCCCTTGAGCTGATTTTAATCAACCTTCTCCTTTTGGGATGGTCAAA
CCTGGAGTTTCAGGTACCGGCTGTCTGTTTACCTCCCCCGGAGCGACCCACTAGTATACTGCCAACAATCAAGTC
TGAGCCAGAGACTGCCGACCCCACACAGCCCAAGCATCTACGAAATTTAAAGAGCACCTTGTTTGAGTTGCTGGA
ACGCATACTCGGGCTTTATTCCAGAATATCATCTGAGAGTATTCCGCCATTGCCCCTCGCAGAAACTGTTATTAG
GTTCTGTAAAATTCTCTCGGCCGTCTATCTGAATGACGGCACGCTCAACCAGCAGGCATTTGACATGATTGTCTT
GGGCAAAGTCCCATCTGGTGGGCTGAGCACTTGCCCACGCTTGAGTATTACTCCTTCAAGACAGCAGATTGTCAA
CATGCTATTTAGAGCATTTCCTTCATCTACCACGGAGCTCATTACCACTGCTGATCGAATCTCAATGCTGGGCGG
TATAGCATCAGTGCTCGGCCCCTTGGGATATCGACGAAAGAAGGCCATGGTTCTTCGAGAACTTGTATCAGTTCT
TATTGGTGGCCTAGTCGAGGCCCGTACACGTGGGGCTGCTGAAGCCGGCATCCACCCTGCCTCTGGCCTGGTGGC
ACTGGCTTCCCCTAGCGATGGGAGCGGCGGCGGACTGGCCCTCGATCTAGGCGAAGGGGATATTGAAAGGGGGCT
TGAAGGCTTTTTGGAGTTGCTGTGCAAGTCGTACGGCATCACTAGTTTTGATGCCACGTCCAATGACTCGGATCA
AGCCGTCGCCAAGAGAGTTATTGAGCAATCTCATTCGAGATTTGTCGGTTACCTCAACATCAAGCTCAACATTCT
TCGAACCTGCATCAATTTTGCCGAAGCGCTACCAGACTTCAATGGAGTACTCAAATTCTCGAGCGATTTGTTGCG
GACAGCAGGATCGGGAGTGGCGCCTAGTTCGCGTAGAGAAGATGCAACGGCTTCGATTGACTCGAATGAGCAGAT
GCGCCTGGTGACCAATATTTCTCGGACAGCGGGCCTTGTTCAGAGAATCAACATGGGAAACCTCACGGCAGAATA
TTGGGATGAATTTCTTGTCAGAAGTATAGTTCTAGATGCGCCGCAAGATGCACGACTGCCTGTACCGCACTCACG
CAGTATATTGCCTGGCGCAAACACGAATCGGATTTCACAAGAGGTCAATCCCTTCATCTACAATCCCTTTCTCAA
AGAGGCGGACGAAGCAGCTGCTCAGAATCTTGCAGCCGGCGAGATTGCCAACTTTCGAGTGACGCTGCAAAACAC
ATATGACGTTGAAGTGGACATTGAAAGCATTCGTTTGTGCACCGAGGGCGTTGATTTTGAAGCAATGAGGGAAAG
TGTGCTGCTCGGACCCTATCGAACTCAGATTCTGCGTGTGCGAGGACGCCCATTGGCCCCAGGCTCCATCAGAGT
CACAGGTGTTATAGTCAAGGTGCGTGGCTGCAGAGAAAGACGGTTTCCCGTATTTGCCAACTCGTGGATGCCGTC
TCCGCCAGAAAAGATCAAGACGAGGGGCGTGGCGGCGCTTCAAACCAGTCTGGGCACGGGTGACAAAGGGCCCGA
GGTCAAGTCACTGGAGCTCAATGTTGTTGAGGCCCAGCCACTTGTGGTTGTCAAGTCGACAACTCTTCCACAATC
CTCAGTTATGATCTTGGAGGGGGAGAGGCAGCGCTTTTCAGTTACTTTGGAAAACAAGTCAAGCATCGCAGTCGA
CATGATGCTCTTTTCATTCAAAGACTCGACACAGGCGCCTCTTCAGGAGGCCCTCAACAAGCGAGACGCCACAGC
GGTGGAGCTGTACGAATACGAGCTGATTCTTGCAAAGAGGCAAGCATTGAGGCTGCTAAAGAGTGAGCAGGCTCG
CAAAATAGCGCCTGGCGAGGAGGCGACGTTTGACTTTGAGATTCTTGGCAAGCCTGGCCTAACAAAGGCAACCAT
TCAAGTCGACTACACGCATCTTGAAGCTGTTCAAGACAATGGTTCGGAACAATTTTATACTCGACAAGTGTCACT
AGACTTGACGGTCACGGTCAATGCCAGTGTGGAACTGACACGGGTAGACGCATTGACCGTGTACGGCAAGATACC
GCAGCCCCTATGGGAGAGGGTTGGCGGCAGCGCGTCAACCGAGGAGGACGAGTACTGCTTGCTTTGCATGGACTT
GCGCAACGCTTGGCCTAGCCACATGACTGTGCGTATAGAAGGGCAAGATGGTCTGGCAGTGGAGGAGAGCATCTT
GCCAGGCAAGACCAGCCGGGTGGTTATGCCAGTGCCAAGGGTCTACTTGGAGAATCCCTACGAGACAATACCAAG
TTTGAATCCATCTCGGACTCGCCAGTTTGTGGTTAGCAGTGGGGTGTCGCCTGAAATGGAAAGGGCCAGTCGAGA
GGCGTTTTGGTACCGAGAAAAGATGCTGGAGAATCTCAAGGCATCGTGGCGGACGACGCTGGCGCCAAAACGGAC
GGGGGCTGTAGAGCTGCGCAACATTCGCCTGACGTCGCGCATGATTGAGGCGATCAAGGTGGACGACGTGGGCAT
TGACGTGTGGGTCGAGGACGCAGGTGGACGGCGATGCAGCGGCGACGCGACGGCGCAGGTGGATGAATTTCTCAA
GGCCAAAGTGCGCGTCAGCAACAAGGGCAAGAGGCCCATGCAGGTGCTGGTGAGACTGCTGCCAGTCTTGTGCCA
TCGAGCGAGCACGGTGTCGCTGGACTACACGCGCAAGTTTGCGTGGAATGGAACGTTGCAGCAGCAGATGACGCC
TCTGGAGCCGCAAGACAGTGTCGACTATGTGCTGGGAGTCACGGCGCTGTGCAGGGGGGAGTTTGAGCTGACGGC
GTCGGTTGAGGAGGTGCAGATCTGGGAGGCTCGAGGCGGCGGACGGCCGCGGTCAGATACCCAAAAGATGAGGGA
TGCGGCGCTGGGAGTCAGGGAGCGACGCATGTGGCATTCACGGCCGTGCCTGTTGACGGTGAGGGACGCGCCTCG
CATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail