Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5741
Gene name
LocationContig_547:2978..3546
Strand+
Gene length (bp)568
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00428 Ribosomal_60s 60s Acidic ribosomal protein 9.7E-26 24 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49148|RLA1_ALTAL 60S acidic ribosomal protein P1 OS=Alternaria alternata GN=ALTA12 PE=1 SV=1 6 111 3.0E-36
sp|Q9HGV0|RLA1_ASPFU 60S acidic ribosomal protein P1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G06830 PE=3 SV=1 6 111 2.0E-30
sp|P50344|RLA1_DAVTA 60S acidic ribosomal protein P1 OS=Davidiella tassiana GN=CLAH12 PE=1 SV=1 1 111 2.0E-27
sp|P17476|RLA1_SCHPO 60S acidic ribosomal protein P1-alpha 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp101 PE=3 SV=1 1 111 1.0E-25
sp|P17477|RLA3_SCHPO 60S acidic ribosomal protein P1-alpha 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp102 PE=3 SV=1 1 111 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49148|RLA1_ALTAL 60S acidic ribosomal protein P1 OS=Alternaria alternata GN=ALTA12 PE=1 SV=1 6 111 3.0E-36
sp|Q9HGV0|RLA1_ASPFU 60S acidic ribosomal protein P1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G06830 PE=3 SV=1 6 111 2.0E-30
sp|P50344|RLA1_DAVTA 60S acidic ribosomal protein P1 OS=Davidiella tassiana GN=CLAH12 PE=1 SV=1 1 111 2.0E-27
sp|P17476|RLA1_SCHPO 60S acidic ribosomal protein P1-alpha 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp101 PE=3 SV=1 1 111 1.0E-25
sp|P17477|RLA3_SCHPO 60S acidic ribosomal protein P1-alpha 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp102 PE=3 SV=1 1 111 1.0E-25
sp|Q9UU78|RLA5_SCHPO 60S acidic ribosomal protein P1-alpha 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp103 PE=1 SV=1 1 111 3.0E-23
sp|P08570|RLA1_DROME 60S acidic ribosomal protein P1 OS=Drosophila melanogaster GN=RpLP1 PE=1 SV=2 6 111 3.0E-20
sp|O01359|RLA1_OSCTI 60S acidic ribosomal protein P1 OS=Oscheius tipulae GN=rpl-21 PE=3 SV=1 7 111 3.0E-19
sp|O23095|RLA12_ARATH 60S acidic ribosomal protein P1-2 OS=Arabidopsis thaliana GN=RPP1B PE=1 SV=2 7 111 2.0E-18
sp|P05318|RLA1_YEAST 60S acidic ribosomal protein P1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1A PE=1 SV=4 4 111 3.0E-18
sp|Q8LCW9|RLA11_ARATH 60S acidic ribosomal protein P1-1 OS=Arabidopsis thaliana GN=RPP1A PE=2 SV=2 7 111 3.0E-17
sp|P52855|RLA1_MAIZE 60S acidic ribosomal protein P1 OS=Zea mays GN=RPP1A PE=1 SV=1 7 111 5.0E-17
sp|Q8LEQ0|RLA13_ARATH 60S acidic ribosomal protein P1-3 OS=Arabidopsis thaliana GN=RPP1C PE=1 SV=2 7 111 8.0E-17
sp|Q9HFQ7|RLA1_CANAL 60S acidic ribosomal protein P1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1A PE=3 SV=1 4 111 2.0E-16
sp|P91913|RLA1_CAEEL 60S acidic ribosomal protein P1 OS=Caenorhabditis elegans GN=rla-1 PE=3 SV=2 5 111 4.0E-16
sp|P02402|RLA1_ARTSA 60S acidic ribosomal protein P1 OS=Artemia salina PE=1 SV=2 7 111 4.0E-14
sp|P10622|RLA3_YEAST 60S acidic ribosomal protein P1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1B PE=1 SV=3 6 111 5.0E-13
sp|P18660|RLA1_CHICK 60S acidic ribosomal protein P1 OS=Gallus gallus GN=RPLP1 PE=3 SV=1 6 111 6.0E-13
sp|P05386|RLA1_HUMAN 60S acidic ribosomal protein P1 OS=Homo sapiens GN=RPLP1 PE=1 SV=1 6 111 1.0E-12
sp|Q56K14|RLA1_BOVIN 60S acidic ribosomal protein P1 OS=Bos taurus GN=RPLP1 PE=3 SV=1 6 111 1.0E-12
sp|A1XQU7|RLA1_PIG 60S acidic ribosomal protein P1 OS=Sus scrofa GN=RPLP1 PE=3 SV=1 6 111 3.0E-12
sp|P47955|RLA1_MOUSE 60S acidic ribosomal protein P1 OS=Mus musculus GN=Rplp1 PE=1 SV=1 6 111 4.0E-12
sp|P19944|RLA1_RAT 60S acidic ribosomal protein P1 OS=Rattus norvegicus GN=Rplp1 PE=3 SV=1 6 111 9.0E-12
sp|Q9HFQ6|RLA3_CANAX 60S acidic ribosomal protein P1-B OS=Candida albicans GN=RPP1B PE=1 SV=1 4 111 5.0E-11
sp|P29763|RLA1_CHLRE 60S acidic ribosomal protein P1 OS=Chlamydomonas reinhardtii PE=3 SV=1 6 111 9.0E-11
sp|P27464|RLA1_POLPE 60S acidic ribosomal protein P1 OS=Polyorchis penicillatus PE=3 SV=1 6 65 3.0E-10
sp|P22684|RLA1_DICDI 60S acidic ribosomal protein P1 OS=Dictyostelium discoideum GN=rplp1 PE=3 SV=1 1 111 1.0E-09
sp|O46313|RLA1_LEIPE 60S acidic ribosomal protein P1 OS=Leishmania peruviana PE=3 SV=1 9 111 4.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3833
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5741 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4858
Ophiocordyceps camponoti-floridani Ophcf2|06868
Ophiocordyceps camponoti-rufipedis Ophun1|4742
Ophiocordyceps kimflemingae Ophio5|922
Ophiocordyceps subramaniannii Hirsu2|7540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5741
MSALHAEQACSYAALILADDGVDISSDKMQSLIKAANISDVEPIWTSIFAKALEGKDVKDLLVNVGSGGGAAPAA
AGAAAVGGDAAAPAAEEKKEEEKEESDEDMGFGLFD*
Coding >OphauG2|5741
ATGTCTGCTTTACATGCCGAGCAGGCTTGCTCCTACGCAGCCTTGATCCTGGCCGACGATGGTGTCGATATTTCG
TCGGACAAGATGCAGAGTCTGATCAAGGCCGCCAATATCAGCGATGTTGAGCCCATCTGGACGTCAATCTTTGCC
AAGGCCCTGGAAGGCAAGGACGTCAAGGACTTGCTCGTCAACGTTGGCTCAGGAGGCGGTGCTGCTCCTGCTGCT
GCTGGCGCTGCTGCCGTCGGCGGTGACGCTGCCGCACCTGCTGCCGAGGAGAAGAAGGAAGAGGAGAAGGAAGAG
TCAGACGAGGATATGGGCTTCGGCTTGTTCGATTAA
Transcript >OphauG2|5741
ATGTCTGCTTTACATGCCGAGCAGGCTTGCTCCTACGCAGCCTTGATCCTGGCCGACGATGGTGTCGATATTTCG
TCGGACAAGATGCAGAGTCTGATCAAGGCCGCCAATATCAGCGATGTTGAGCCCATCTGGACGTCAATCTTTGCC
AAGGCCCTGGAAGGCAAGGACGTCAAGGACTTGCTCGTCAACGTTGGCTCAGGAGGCGGTGCTGCTCCTGCTGCT
GCTGGCGCTGCTGCCGTCGGCGGTGACGCTGCCGCACCTGCTGCCGAGGAGAAGAAGGAAGAGGAGAAGGAAGAG
TCAGACGAGGATATGGGCTTCGGCTTGTTCGATTAA
Gene >OphauG2|5741
ATGTCTGCTTTACATGCCGAGCAGGCTTGCTCCTACGCAGCCTTGATCCTGGCCGACGATGGTGTCGATATTTCG
GTTAGTCCAGTCCATACTGTCACCACGACGCGCCCGTCAACAATACTGCATCCTTGTTAGTCCATGGGCTGACTC
TATGACAGTCGGACAAGATGCAGAGTCTGATCAAGGCCGCCAATATCAGCGATGTTGAGCCCATCTGGACGTCAA
TCTTTGCCAAGGTACGACACCGATGCCCAGACCTCTCAGACTCTTAGCCATGTGTGCATCGCTCATTGGTCCTGA
TTTTTTTCTCCGCCCTTTCTTAGGCCCTGGAAGGCAAGGACGTCAAGGACTTGCTCGTCAACGTTGGCTCAGGAG
GCGGTGCTGCTCCTGCTGCTGCTGGCGCTGCTGCCGTCGGCGGTGACGCTGCCGCACCTGCTGCCGAGGAGAAGA
AGGAAGAGGGTTCGTCATCTTACCACGCCCATGCTCTTACGGGCCGCCCATTTGCTCACACCTTGCTACAGAGAA
GGAAGAGTCAGACGAGGATATGGGCTTCGGCTTGTTCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail