Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5737
Gene name
LocationContig_546:7719..8321
Strand+
Gene length (bp)602
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5737 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2241
Ophiocordyceps camponoti-floridani Ophcf2|05098
Ophiocordyceps camponoti-rufipedis Ophun1|3269
Ophiocordyceps kimflemingae Ophio5|3223
Ophiocordyceps subramaniannii Hirsu2|3586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5737
MTTTAAPPQSTPPAISSEPNKAFVSKWSSRYRGATVQDLDPPAALSLNPYDKVSLALVSAFERDYTHLTVVDRDT
RALLGYISIPRLQSLLDAGRIKPDDALRSAMTRFRRDARNPYRIITLQTPLEQLEDFFRAGVPDGPWRQLFAVVT
DENRRFVLGVATVQDLEEFVKRRPA*
Coding >OphauG2|5737
ATGACCACAACAGCGGCTCCGCCTCAAAGCACGCCTCCCGCTATATCCTCAGAACCAAACAAGGCATTTGTGTCC
AAGTGGTCATCGCGCTATCGCGGCGCCACGGTCCAAGATCTCGACCCCCCAGCCGCCCTCTCACTTAATCCTTAC
GACAAGGTTTCACTTGCCCTCGTCTCGGCATTCGAACGCGACTACACCCACCTTACCGTTGTCGACCGCGACACT
CGTGCGCTCCTCGGCTACATCTCCATCCCCCGCCTACAGTCCTTGCTTGACGCAGGCCGCATCAAGCCCGACGAT
GCCCTCCGCTCCGCCATGACTCGCTTCCGCCGCGACGCCCGCAATCCCTATCGAATCATTACCCTCCAAACCCCC
CTAGAGCAGCTGGAAGATTTTTTCCGTGCTGGCGTTCCCGACGGACCTTGGAGACAGCTCTTTGCCGTGGTGACG
GATGAAAATCGCCGCTTCGTCCTCGGAGTTGCCACTGTACAGGACCTTGAAGAGTTTGTCAAGCGAAGGCCTGCC
TGA
Transcript >OphauG2|5737
ATGACCACAACAGCGGCTCCGCCTCAAAGCACGCCTCCCGCTATATCCTCAGAACCAAACAAGGCATTTGTGTCC
AAGTGGTCATCGCGCTATCGCGGCGCCACGGTCCAAGATCTCGACCCCCCAGCCGCCCTCTCACTTAATCCTTAC
GACAAGGTTTCACTTGCCCTCGTCTCGGCATTCGAACGCGACTACACCCACCTTACCGTTGTCGACCGCGACACT
CGTGCGCTCCTCGGCTACATCTCCATCCCCCGCCTACAGTCCTTGCTTGACGCAGGCCGCATCAAGCCCGACGAT
GCCCTCCGCTCCGCCATGACTCGCTTCCGCCGCGACGCCCGCAATCCCTATCGAATCATTACCCTCCAAACCCCC
CTAGAGCAGCTGGAAGATTTTTTCCGTGCTGGCGTTCCCGACGGACCTTGGAGACAGCTCTTTGCCGTGGTGACG
GATGAAAATCGCCGCTTCGTCCTCGGAGTTGCCACTGTACAGGACCTTGAAGAGTTTGTCAAGCGAAGGCCTGCC
TGA
Gene >OphauG2|5737
ATGACCACAACAGCGGCTCCGCCTCAAAGCACGCCTCCCGCTATATCCTCAGAACCAAACAAGGCATTTGTGTCC
AAGTGGTCATCGCGCTATCGCGGCGTAGGTTGTCTTGCGCCCTGAGCTTAAACAAGCCAGCCAAAATTGCCTGAC
ATTGACATGGTGCTCTCTTGTAGGCCACGGTCCAAGATCTCGACCCCCCAGCCGCCCTCTCACTTAATCCTTACG
ACAAGGTTTCACTTGCCCTCGTCTCGGCATTCGAACGCGACTACACCCACCTTACCGTTGTCGACCGCGACACTC
GTGCGCTCCTCGGCTACATCTCCATCCCCCGCCTACAGTCCTTGCTTGACGCAGGCCGCATCAAGCCCGACGATG
CCCTCCGCTCCGCCATGACTCGCTTCCGCCGCGACGCCCGCAATCCCTATCGAATCATTACCCTCCAAACCCCCC
TAGAGCAGCTGGAAGATTTTTTCCGTGCTGGCGTTCCCGACGGACCTTGGAGACAGCTCTTTGCCGTGGTGACGG
ATGAAAATCGCCGCTTCGTCCTCGGAGTTGCCACTGTACAGGACCTTGAAGAGTTTGTCAAGCGAAGGCCTGCCT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail