Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5719
Gene name
LocationContig_541:1387..5580
Strand-
Gene length (bp)4193
Transcript length (bp)4062
Coding sequence length (bp)4062
Protein length (aa) 1354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13857 Ank_5 Ankyrin repeats (many copies) 2.6E-12 981 1035
PF00023 Ank Ankyrin repeat 9.7E-06 962 992
PF00023 Ank Ankyrin repeat 2.5E-03 995 1024
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.2E-10 956 1024
PF01833 TIG IPT/TIG domain 6.8E-09 780 857
PF13637 Ank_4 Ankyrin repeats (many copies) 4.4E-08 964 1013
PF20144 TIG_SUH TIG domain 1.8E-05 798 835

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 780 1124 2.0E-37
sp|O13987|YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.05 PE=3 SV=1 780 1055 2.0E-31
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 780 1078 8.0E-29
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 315 535 1.0E-19
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 314 535 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 780 1124 2.0E-37
sp|O13987|YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.05 PE=3 SV=1 780 1055 2.0E-31
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 780 1078 8.0E-29
sp|P35210|SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT23 PE=1 SV=2 315 535 1.0E-19
sp|P40578|MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA2 PE=1 SV=1 314 535 2.0E-18
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 966 1076 2.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 966 1076 2.0E-10
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 966 1076 2.0E-10
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 966 1076 2.0E-10
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 958 1045 2.0E-08
sp|A2AQH4|BCORL_MOUSE BCL-6 corepressor-like protein 1 OS=Mus musculus GN=Bcorl1 PE=2 SV=1 899 1112 2.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 958 1045 2.0E-08
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 955 1046 3.0E-08
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 964 1046 5.0E-08
sp|Q6W2J9|BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens GN=BCOR PE=1 SV=1 899 1044 8.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 896 1036 8.0E-08
sp|Q5H9F3|BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens GN=BCORL1 PE=1 SV=1 931 1053 9.0E-08
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 958 1050 1.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 896 1036 1.0E-07
sp|Q8CGN4|BCOR_MOUSE BCL-6 corepressor OS=Mus musculus GN=Bcor PE=1 SV=2 899 1044 1.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 951 1059 2.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 951 1059 2.0E-07
sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 934 1035 3.0E-07
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 958 1048 3.0E-07
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 958 1045 3.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 964 1035 3.0E-07
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 939 1035 3.0E-07
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 958 1130 4.0E-07
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 958 1071 4.0E-07
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 966 1059 6.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 949 1046 6.0E-07
sp|Q03017|CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster GN=cact PE=1 SV=2 962 1050 6.0E-07
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 964 1038 8.0E-07
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 958 1071 8.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 964 1035 8.0E-07
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 962 1046 9.0E-07
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 939 1035 1.0E-06
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 962 1046 1.0E-06
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 939 1035 1.0E-06
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 949 1046 1.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 966 1059 2.0E-06
sp|O22265|SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=CAO PE=1 SV=2 926 1039 2.0E-06
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 928 1038 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 955 1035 3.0E-06
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 955 1033 3.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 955 1035 3.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 936 1036 3.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 951 1038 3.0E-06
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 958 1048 3.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 964 1035 3.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 964 1035 4.0E-06
sp|O00221|IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 922 1041 4.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 952 1035 5.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 934 1035 6.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 966 1038 6.0E-06
sp|Q9D119|PPR27_MOUSE Protein phosphatase 1 regulatory subunit 27 OS=Mus musculus GN=Ppp1r27 PE=2 SV=1 950 1020 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0050794 regulation of cellular process No
GO:0031326 regulation of cellular biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0031323 regulation of cellular metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0051252 regulation of RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5719
MTPAPATGAASPLIAGAGMASGDFRDLDDDFNASNLFDFSNSPDTLQSLEKMDQKAFLNPQELTAGPLPDSPNDS
YHDSSSESASSTKRTGSSESAKTPAHTITGDGLDIKMDWANPEYASFDDDENAFTLTDHSTMMDGIYSFADNEDS
FIDQSFDFEGASSSPEAPLTVQMNMPSPGMPIIKTSSPRKTGNAHGAKVGGGHKKRASQLSMAFSVNGTRPTSRD
VSPMSALVTSHDSSPAATLFNSPSPSVIHDLTRNINGNVMWPSKLEMARPDHMSVSMPYGGAMPQPAVALHQQLR
MFGSMPFNFNGGYELRIMPTPLKSRVETQIPIKMTLLPLPPGVTKLHLPGHTISKPKLLAKPPPERSPDTLELYV
TLVCTSAMEQPGMKQKALERATKLPQGHLPDVDDEHSPQNGGDVRICQGCITRERKRAARKKIKKPEEEKLWSLD
EERRVIVFNTQEIKEWQPLSGVVDSSGRPEAVVSNRAMQIDAPMRIACYCRHHNEKMGFNVIFTIKDYQDRVIAQ
AMSNPIMITDDHKTHPMAGQSSQQAMSDTVTSSTVPMGPDSNTVMSPTQMAAFCVPPSNGDVAMGQANGQQASYH
ASPSSSKTTPTMSSTPAPTRAMSRPASPSLGGPASKKRKSSGSGSSRVPNGLTMTRLETSPPPPAPAPQTAAGPQ
LSAAASPFSPKTASFSQLDQVFGQPPFTNGPPTPSGSNEHAPLFSANRSASMDNLAMAQLYSAPTSKHGSRAPSP
SALPQNQFGPSLASGLFPLSIGVSQTRPPPMIHKIIPNEGPKMGGIEVTVLGQAFFQGLEVWFGDQKATTTTYWG
DSSLVCLLPPSPVAGAVAVTFKHQGVPGAQTFPMAKEPPIFKYIDDNENKLIRTALSVLGHKMSGQMVDVSDLAR
RILNDGNSAWTGPSSMGPSSGGTGFSHASQEHLESQLLRCLDLIDLDDSAHKTQLDLKRPTGHTMLHLACSIGYH
RFVAALLARGANPDARDRGGYTPLHMAAIHNRPEIARRLMIAGADPTVRSLSGLTAADVAQSRLVLRAIHQSERR
SRSFSGASLRSRASSNTSLRSLLEPLARAQTHDEPIALDAGEESPEYTSGDFEDEDPDEDCYVDAKRPMCREQEE
KGVQEWDQDDKSDDLNGPESPTTQLAAIKEALRDNFQQPLHQFQQSMALHLQNLAQMPQMPTFPGIPMLPDYQAY
LQQAPFVRRMQQLMPGSGPRPEAAEEGGKLDGRWWDILSYMQSSAAPPAYEDIFGRQSSDTKQECAIRAAADAEA
DMKCSAMYDKPMAGVETEAEAAETGSRSRANSPGVLKIGRKNAITKEQQEQFLRAHEKKLKKISSDRNLFFIWSS
GAN*
Coding >OphauG2|5719
ATGACTCCTGCGCCAGCAACAGGCGCCGCTAGCCCTCTAATCGCGGGAGCCGGCATGGCGAGCGGCGATTTTCGC
GACTTGGATGATGACTTTAATGCTTCAAACCTCTTTGACTTCTCAAATAGCCCCGATACCCTGCAAAGCTTGGAA
AAAATGGACCAAAAAGCATTTCTGAACCCCCAGGAGCTGACGGCTGGCCCGCTGCCCGATTCGCCCAACGACTCA
TACCACGACTCGTCGTCCGAGTCGGCTTCGTCAACAAAGCGCACAGGTAGTTCAGAATCAGCAAAAACCCCTGCA
CATACAATCACGGGCGATGGCCTCGACATCAAGATGGACTGGGCAAACCCTGAATACGCTTCATTTGACGACGAC
GAGAATGCCTTTACCCTCACTGATCACTCCACCATGATGGACGGCATATACTCGTTTGCCGACAATGAAGACAGC
TTCATTGACCAGTCTTTTGATTTTGAAGGTGCCTCGAGCAGTCCTGAAGCCCCATTAACAGTTCAGATGAACATG
CCGTCTCCCGGCATGCCAATAATCAAGACTAGCAGCCCGCGAAAGACTGGAAACGCTCATGGGGCAAAGGTTGGC
GGCGGGCACAAGAAACGAGCCTCTCAACTCTCCATGGCCTTTTCTGTCAATGGAACAAGGCCGACCTCGAGGGAT
GTGTCCCCCATGTCCGCCTTGGTGACCAGCCATGACTCATCCCCTGCCGCCACCTTGTTCAACTCTCCCTCCCCG
AGCGTTATCCACGACTTGACACGAAACATCAACGGCAACGTCATGTGGCCAAGCAAGCTCGAAATGGCCAGGCCA
GACCACATGTCTGTCTCGATGCCGTATGGCGGCGCCATGCCCCAACCAGCCGTCGCTCTACACCAGCAGCTCCGT
ATGTTCGGCTCGATGCCTTTCAACTTTAACGGCGGCTACGAGCTCAGAATCATGCCGACGCCACTCAAGTCTCGT
GTGGAGACACAGATTCCAATCAAGATGACGCTGCTGCCATTGCCGCCTGGCGTCACCAAGCTGCATCTTCCAGGC
CACACGATATCAAAACCCAAGCTGCTCGCCAAACCACCACCAGAGCGATCGCCGGATACACTGGAGCTTTACGTG
ACTCTTGTCTGCACGAGTGCCATGGAACAGCCGGGCATGAAGCAAAAGGCTCTTGAGAGAGCTACCAAACTCCCA
CAAGGCCATCTTCCCGATGTCGACGATGAACATTCGCCCCAGAACGGCGGCGACGTGCGCATCTGCCAGGGATGC
ATCACGCGAGAACGCAAGCGGGCGGCACGCAAAAAGATCAAGAAGCCGGAAGAAGAGAAGCTGTGGAGCCTTGAC
GAAGAGCGGCGCGTCATTGTCTTCAACACGCAAGAAATCAAGGAGTGGCAGCCTTTGAGCGGCGTCGTCGATTCG
AGCGGGCGACCAGAGGCGGTGGTGTCGAATCGAGCCATGCAAATCGACGCCCCAATGCGCATTGCCTGCTATTGC
CGGCACCACAATGAGAAGATGGGCTTCAATGTCATCTTCACCATCAAGGACTATCAGGACCGTGTCATTGCCCAG
GCCATGTCCAATCCCATCATGATTACCGACGACCACAAGACGCATCCCATGGCCGGCCAATCGTCACAGCAGGCC
ATGTCAGACACTGTCACTTCGTCAACCGTGCCCATGGGCCCCGACTCGAATACTGTCATGTCGCCGACGCAAATG
GCAGCCTTTTGTGTGCCTCCTTCCAACGGTGATGTTGCAATGGGCCAAGCCAACGGGCAACAAGCGTCGTATCAT
GCCTCTCCCTCGTCCAGCAAGACGACACCAACCATGAGCTCGACTCCTGCGCCTACTCGAGCCATGTCTCGGCCG
GCATCTCCTAGCCTGGGCGGCCCGGCATCCAAGAAGAGGAAGTCGAGCGGGAGCGGCAGCTCCAGAGTACCCAAC
GGCCTAACAATGACGCGGCTCGAAACTTCGCCGCCGCCGCCGGCGCCGGCGCCACAGACTGCTGCCGGCCCCCAA
TTGTCTGCAGCTGCATCTCCCTTCTCGCCAAAAACGGCCTCCTTCTCGCAACTTGACCAAGTCTTTGGGCAGCCA
CCCTTTACCAATGGTCCGCCAACTCCATCTGGCAGCAACGAGCACGCACCGCTGTTTTCTGCAAACCGCTCGGCG
AGCATGGATAACCTGGCCATGGCTCAGCTCTACTCGGCGCCAACGTCAAAGCATGGCAGTCGGGCGCCCAGCCCC
TCTGCCCTGCCGCAGAATCAGTTTGGGCCCTCGCTTGCCAGCGGCCTCTTCCCCCTGTCGATTGGGGTTAGCCAA
ACGCGTCCTCCTCCCATGATTCACAAGATTATACCCAATGAAGGGCCCAAGATGGGCGGCATCGAAGTTACGGTT
TTGGGTCAGGCGTTTTTCCAGGGACTCGAGGTCTGGTTTGGCGATCAAAAAGCCACGACCACTACCTACTGGGGC
GACTCGTCGCTGGTTTGTCTGCTGCCGCCCTCGCCCGTTGCGGGTGCCGTTGCCGTTACATTCAAGCACCAGGGT
GTTCCGGGCGCACAGACATTTCCCATGGCAAAGGAGCCACCCATTTTCAAGTATATTGACGACAATGAGAATAAG
CTGATTCGAACTGCTCTGTCGGTCCTCGGCCACAAGATGTCGGGCCAGATGGTGGACGTCAGTGATTTGGCTCGA
CGCATCTTGAACGACGGAAACTCAGCCTGGACCGGCCCATCGTCCATGGGCCCGTCTTCTGGAGGTACTGGATTC
AGTCACGCTTCTCAAGAGCACCTCGAGTCCCAGCTTCTCAGATGCCTTGATCTCATCGACTTGGACGACAGCGCA
CACAAGACGCAGCTGGATCTCAAGCGGCCCACAGGCCACACCATGCTTCACCTTGCGTGCTCGATTGGCTATCAT
CGATTTGTTGCTGCCTTGTTGGCCCGTGGAGCGAACCCGGATGCTCGAGACCGTGGCGGCTACACACCTCTGCAC
ATGGCAGCAATCCACAACCGTCCAGAGATTGCCAGACGTCTGATGATTGCTGGAGCCGACCCAACAGTGCGCAGT
TTATCGGGTCTCACGGCGGCCGATGTGGCGCAATCACGCTTGGTCCTTAGGGCCATTCACCAGTCGGAGCGACGC
TCACGTTCTTTTAGTGGCGCTTCGCTACGCAGCCGGGCTAGCAGCAACACGTCGCTGCGGTCGCTGCTGGAGCCT
TTGGCCAGGGCGCAGACACACGACGAGCCGATTGCGCTTGATGCTGGAGAGGAAAGCCCAGAGTATACTTCGGGA
GACTTTGAAGACGAAGACCCCGACGAGGACTGCTATGTGGATGCGAAGCGGCCCATGTGTCGCGAGCAAGAGGAA
AAGGGCGTGCAAGAATGGGATCAAGATGACAAGAGCGACGATTTGAATGGCCCAGAATCACCAACGACGCAATTG
GCCGCGATCAAGGAGGCGCTGAGAGACAACTTTCAACAGCCGCTGCATCAGTTTCAGCAGTCAATGGCATTGCAC
CTCCAGAACCTTGCACAGATGCCGCAGATGCCGACGTTTCCTGGTATACCCATGCTGCCAGATTACCAGGCCTAT
CTTCAGCAGGCACCTTTTGTGCGACGCATGCAACAACTTATGCCTGGATCTGGACCTCGGCCGGAGGCGGCAGAG
GAGGGCGGCAAACTGGATGGCCGGTGGTGGGACATCTTGTCATACATGCAGAGCAGTGCCGCCCCGCCAGCATAC
GAAGATATTTTTGGACGACAGAGTTCTGACACGAAACAAGAGTGTGCGATTAGAGCCGCTGCAGATGCCGAAGCA
GACATGAAGTGCTCAGCCATGTACGACAAGCCAATGGCTGGAGTGGAAACAGAGGCAGAGGCGGCCGAGACTGGG
TCGAGAAGCCGGGCGAATTCGCCTGGGGTGCTCAAGATTGGACGCAAAAATGCCATTACCAAGGAGCAGCAAGAG
CAGTTTCTCAGAGCTCACGAAAAGAAGCTCAAGAAGATTAGCAGCGACCGCAACCTCTTTTTCATTTGGTCGAGT
GGAGCTAATTAG
Transcript >OphauG2|5719
ATGACTCCTGCGCCAGCAACAGGCGCCGCTAGCCCTCTAATCGCGGGAGCCGGCATGGCGAGCGGCGATTTTCGC
GACTTGGATGATGACTTTAATGCTTCAAACCTCTTTGACTTCTCAAATAGCCCCGATACCCTGCAAAGCTTGGAA
AAAATGGACCAAAAAGCATTTCTGAACCCCCAGGAGCTGACGGCTGGCCCGCTGCCCGATTCGCCCAACGACTCA
TACCACGACTCGTCGTCCGAGTCGGCTTCGTCAACAAAGCGCACAGGTAGTTCAGAATCAGCAAAAACCCCTGCA
CATACAATCACGGGCGATGGCCTCGACATCAAGATGGACTGGGCAAACCCTGAATACGCTTCATTTGACGACGAC
GAGAATGCCTTTACCCTCACTGATCACTCCACCATGATGGACGGCATATACTCGTTTGCCGACAATGAAGACAGC
TTCATTGACCAGTCTTTTGATTTTGAAGGTGCCTCGAGCAGTCCTGAAGCCCCATTAACAGTTCAGATGAACATG
CCGTCTCCCGGCATGCCAATAATCAAGACTAGCAGCCCGCGAAAGACTGGAAACGCTCATGGGGCAAAGGTTGGC
GGCGGGCACAAGAAACGAGCCTCTCAACTCTCCATGGCCTTTTCTGTCAATGGAACAAGGCCGACCTCGAGGGAT
GTGTCCCCCATGTCCGCCTTGGTGACCAGCCATGACTCATCCCCTGCCGCCACCTTGTTCAACTCTCCCTCCCCG
AGCGTTATCCACGACTTGACACGAAACATCAACGGCAACGTCATGTGGCCAAGCAAGCTCGAAATGGCCAGGCCA
GACCACATGTCTGTCTCGATGCCGTATGGCGGCGCCATGCCCCAACCAGCCGTCGCTCTACACCAGCAGCTCCGT
ATGTTCGGCTCGATGCCTTTCAACTTTAACGGCGGCTACGAGCTCAGAATCATGCCGACGCCACTCAAGTCTCGT
GTGGAGACACAGATTCCAATCAAGATGACGCTGCTGCCATTGCCGCCTGGCGTCACCAAGCTGCATCTTCCAGGC
CACACGATATCAAAACCCAAGCTGCTCGCCAAACCACCACCAGAGCGATCGCCGGATACACTGGAGCTTTACGTG
ACTCTTGTCTGCACGAGTGCCATGGAACAGCCGGGCATGAAGCAAAAGGCTCTTGAGAGAGCTACCAAACTCCCA
CAAGGCCATCTTCCCGATGTCGACGATGAACATTCGCCCCAGAACGGCGGCGACGTGCGCATCTGCCAGGGATGC
ATCACGCGAGAACGCAAGCGGGCGGCACGCAAAAAGATCAAGAAGCCGGAAGAAGAGAAGCTGTGGAGCCTTGAC
GAAGAGCGGCGCGTCATTGTCTTCAACACGCAAGAAATCAAGGAGTGGCAGCCTTTGAGCGGCGTCGTCGATTCG
AGCGGGCGACCAGAGGCGGTGGTGTCGAATCGAGCCATGCAAATCGACGCCCCAATGCGCATTGCCTGCTATTGC
CGGCACCACAATGAGAAGATGGGCTTCAATGTCATCTTCACCATCAAGGACTATCAGGACCGTGTCATTGCCCAG
GCCATGTCCAATCCCATCATGATTACCGACGACCACAAGACGCATCCCATGGCCGGCCAATCGTCACAGCAGGCC
ATGTCAGACACTGTCACTTCGTCAACCGTGCCCATGGGCCCCGACTCGAATACTGTCATGTCGCCGACGCAAATG
GCAGCCTTTTGTGTGCCTCCTTCCAACGGTGATGTTGCAATGGGCCAAGCCAACGGGCAACAAGCGTCGTATCAT
GCCTCTCCCTCGTCCAGCAAGACGACACCAACCATGAGCTCGACTCCTGCGCCTACTCGAGCCATGTCTCGGCCG
GCATCTCCTAGCCTGGGCGGCCCGGCATCCAAGAAGAGGAAGTCGAGCGGGAGCGGCAGCTCCAGAGTACCCAAC
GGCCTAACAATGACGCGGCTCGAAACTTCGCCGCCGCCGCCGGCGCCGGCGCCACAGACTGCTGCCGGCCCCCAA
TTGTCTGCAGCTGCATCTCCCTTCTCGCCAAAAACGGCCTCCTTCTCGCAACTTGACCAAGTCTTTGGGCAGCCA
CCCTTTACCAATGGTCCGCCAACTCCATCTGGCAGCAACGAGCACGCACCGCTGTTTTCTGCAAACCGCTCGGCG
AGCATGGATAACCTGGCCATGGCTCAGCTCTACTCGGCGCCAACGTCAAAGCATGGCAGTCGGGCGCCCAGCCCC
TCTGCCCTGCCGCAGAATCAGTTTGGGCCCTCGCTTGCCAGCGGCCTCTTCCCCCTGTCGATTGGGGTTAGCCAA
ACGCGTCCTCCTCCCATGATTCACAAGATTATACCCAATGAAGGGCCCAAGATGGGCGGCATCGAAGTTACGGTT
TTGGGTCAGGCGTTTTTCCAGGGACTCGAGGTCTGGTTTGGCGATCAAAAAGCCACGACCACTACCTACTGGGGC
GACTCGTCGCTGGTTTGTCTGCTGCCGCCCTCGCCCGTTGCGGGTGCCGTTGCCGTTACATTCAAGCACCAGGGT
GTTCCGGGCGCACAGACATTTCCCATGGCAAAGGAGCCACCCATTTTCAAGTATATTGACGACAATGAGAATAAG
CTGATTCGAACTGCTCTGTCGGTCCTCGGCCACAAGATGTCGGGCCAGATGGTGGACGTCAGTGATTTGGCTCGA
CGCATCTTGAACGACGGAAACTCAGCCTGGACCGGCCCATCGTCCATGGGCCCGTCTTCTGGAGGTACTGGATTC
AGTCACGCTTCTCAAGAGCACCTCGAGTCCCAGCTTCTCAGATGCCTTGATCTCATCGACTTGGACGACAGCGCA
CACAAGACGCAGCTGGATCTCAAGCGGCCCACAGGCCACACCATGCTTCACCTTGCGTGCTCGATTGGCTATCAT
CGATTTGTTGCTGCCTTGTTGGCCCGTGGAGCGAACCCGGATGCTCGAGACCGTGGCGGCTACACACCTCTGCAC
ATGGCAGCAATCCACAACCGTCCAGAGATTGCCAGACGTCTGATGATTGCTGGAGCCGACCCAACAGTGCGCAGT
TTATCGGGTCTCACGGCGGCCGATGTGGCGCAATCACGCTTGGTCCTTAGGGCCATTCACCAGTCGGAGCGACGC
TCACGTTCTTTTAGTGGCGCTTCGCTACGCAGCCGGGCTAGCAGCAACACGTCGCTGCGGTCGCTGCTGGAGCCT
TTGGCCAGGGCGCAGACACACGACGAGCCGATTGCGCTTGATGCTGGAGAGGAAAGCCCAGAGTATACTTCGGGA
GACTTTGAAGACGAAGACCCCGACGAGGACTGCTATGTGGATGCGAAGCGGCCCATGTGTCGCGAGCAAGAGGAA
AAGGGCGTGCAAGAATGGGATCAAGATGACAAGAGCGACGATTTGAATGGCCCAGAATCACCAACGACGCAATTG
GCCGCGATCAAGGAGGCGCTGAGAGACAACTTTCAACAGCCGCTGCATCAGTTTCAGCAGTCAATGGCATTGCAC
CTCCAGAACCTTGCACAGATGCCGCAGATGCCGACGTTTCCTGGTATACCCATGCTGCCAGATTACCAGGCCTAT
CTTCAGCAGGCACCTTTTGTGCGACGCATGCAACAACTTATGCCTGGATCTGGACCTCGGCCGGAGGCGGCAGAG
GAGGGCGGCAAACTGGATGGCCGGTGGTGGGACATCTTGTCATACATGCAGAGCAGTGCCGCCCCGCCAGCATAC
GAAGATATTTTTGGACGACAGAGTTCTGACACGAAACAAGAGTGTGCGATTAGAGCCGCTGCAGATGCCGAAGCA
GACATGAAGTGCTCAGCCATGTACGACAAGCCAATGGCTGGAGTGGAAACAGAGGCAGAGGCGGCCGAGACTGGG
TCGAGAAGCCGGGCGAATTCGCCTGGGGTGCTCAAGATTGGACGCAAAAATGCCATTACCAAGGAGCAGCAAGAG
CAGTTTCTCAGAGCTCACGAAAAGAAGCTCAAGAAGATTAGCAGCGACCGCAACCTCTTTTTCATTTGGTCGAGT
GGAGCTAATTAG
Gene >OphauG2|5719
ATGACTCCTGCGCCAGCAACAGGCGCCGCTAGCCCTCTAATCGCGGGAGCCGGCATGGCGAGCGGCGATTTTCGC
GACTTGGATGATGACTTTAATGCTTCAAACCTCTTTGACTTCTCAAATAGCCCCGATACCCTGCAAAGCTTGGAA
AAAATGGACCAAAAAGCATTTCTGAACCCCCAGGAGCTGACGGCTGGCCCGCTGCCCGATTCGCCCAACGACTCA
TACCACGACTCGTCGTCCGAGTCGGCTTCGTCAACAAAGCGCACAGGTAGTTCAGAATCAGCAAAAACCCCTGCA
CATACAATCACGGGCGATGGCCTCGACATCAAGATGGACTGGGCAAACCCTGAATACGCTTCATTTGACGACGAC
GAGAATGCCTTTACCCTCACTGATCACTCCACCATGATGGACGGCATATACTCGTTTGCCGACAATGAAGACAGC
TTCATTGACCAGTCTTTTGATTTTGAAGGTGCCTCGAGCAGTCCTGAAGCCCCATTAACAGTTCAGATGAACATG
CCGTCTCCCGGCATGCCAATAATCAAGACTAGCAGCCCGCGAAAGACTGGAAACGCTCATGGGGCAAAGGTTGGC
GGCGGGCACAAGAAACGAGCCTCTGTAAGTGAATTGTTCAATCCTGCACTCCACGCACTAGGTGGCTCATGCTTG
ATTTCTTGTTAGCAACTCTCCATGGCCTTTTCTGTCAATGGAACAAGGCCGACCTCGAGGGATGTGTCCCCCATG
TCCGCCTTGGTGACCAGCCATGACTCATCCCCTGCCGCCACCTTGTTCAACTCTCCCTCCCCGAGCGTTATCCAC
GACTTGACACGAAACATCAACGGCAACGTCATGTGGCCAAGCAAGCTCGAAATGGCCAGGCCAGACCACATGTCT
GTCTCGATGCCGTATGGCGGCGCCATGCCCCAACCAGCCGTCGCTCTACACCAGCAGCTCCGTATGTTCGGCTCG
ATGCCTTTCAACTTTAACGGCGGCTACGAGCTCAGAATCATGCCGACGCCACTCAAGTCTCGTGTGGAGACACAG
ATTCCAATCAAGATGACGCTGCTGCCATTGCCGCCTGGCGTCACCAAGCTGCATCTTCCAGGCCACACGATATCA
AAACCCAAGCTGCTCGCCAAACCACCACCAGAGCGATCGCCGGATACACTGGAGCTTTACGTGACTCTTGTCTGC
ACGAGTGCCATGGAACAGCCGGGCATGAAGCAAAAGGCTCTTGAGAGAGCTACCAAACTCCCACAAGGCCATCTT
CCCGATGTCGACGATGAACATTCGCCCCAGAACGGCGGCGACGTGCGCATCTGCCAGGGATGCATCACGCGAGAA
CGCAAGCGGGCGGCACGCAAAAAGATCAAGAAGCCGGAAGAAGAGAAGCTGTGGAGCCTTGACGAAGAGCGGCGC
GTCATTGTCTTCAACACGCAAGAAATCAAGGAGTGGCAGCCTTTGAGCGGCGTCGTCGATTCGAGCGGGCGACCA
GAGGCGGTGGTGTCGAATCGAGCCATGCAAATCGACGCCCCAATGCGCATTGCCTGCTATTGCCGGCACCACAAT
GAGAAGATGGGCTTCAATGTCATCTTCACCATCAAGGACTATCAGGACCGTGTCATTGCCCAGGCCATGTCCAAT
CCCATCATGATTACCGACGACCACAAGACGCATCCCATGGCCGGCCAATCGTCACAGCAGGCCATGTCAGACACT
GTCACTTCGTCAACCGTGCCCATGGGCCCCGACTCGAATACTGTCATGTCGCCGACGCAAATGGCAGCCTTTTGT
GTGCCTCCTTCCAACGGTGATGTTGCAATGGGCCAAGCCAACGGGCAACAAGCGTCGTATCATGCCTCTCCCTCG
TCCAGCAAGACGACACCAACCATGAGCTCGACTCCTGCGCCTACTCGAGCCATGTCTCGGCCGGCATCTCCTAGC
CTGGGCGGCCCGGCATCCAAGAAGAGGAAGTCGAGCGGGAGCGGCAGCTCCAGAGTACCCAACGGCCTAACAATG
ACGCGGCTCGAAACTTCGCCGCCGCCGCCGGCGCCGGCGCCACAGACTGCTGCCGGCCCCCAATTGTCTGCAGCT
GCATCTCCCTTCTCGCCAAAAACGGCCTCCTTCTCGCAACTTGACCAAGTCTTTGGGCAGCCACCCTTTACCAAT
GGTCCGCCAACTCCATCTGGCAGCAACGAGCACGCACCGCTGTTTTCTGCAAACCGCTCGGCGAGCATGGATAAC
CTGGCCATGGCTCAGCTCTACTCGGCGCCAACGTCAAAGCATGGCAGTCGGGCGCCCAGCCCCTCTGCCCTGCCG
CAGAATCAGTTTGGGCCCTCGCTTGCCAGCGGCCTCTTCCCCCTGTCGATTGGGGTTAGCCAAACGCGTCCTCCT
CCCATGATTCACAAGATTATACCCAATGAAGGGCCCAAGATGGGCGGCATCGAAGTTACGGTTTTGGGTCAGGCG
TTTTTCCAGGGACTCGAGGTCTGGTTTGGCGATCAAAAAGCCACGACCACTACCTACTGGGGCGACTCGTCGCTG
GTTTGTCTGCTGCCGCCCTCGCCCGTTGCGGGTGCCGTTGCCGTTACATTCAAGCACCAGGGTGTTCCGGGCGCA
CAGACATTTCCCATGGCAAAGGAGCCACCCATTTTCAAGTATATTGACGACAATGAGAATAAGCTGATTCGAACT
GCTCTGTCGGTCCTCGGCCACAAGATGTCGGGCCAGATGGTGGACGTCAGTGATTTGGCTCGACGCATCTTGAAC
GACGGAAACTCAGCCTGGACCGGCCCATCGTCCATGGGCCCGTCTTCTGGAGGTACTGGATTCAGTCACGCTTCT
CAAGAGCACCTCGAGTCCCAGCTTCTCAGATGCCTTGATCTCATCGACTTGGACGACAGCGCACACAAGACGCAG
CTGGATCTCAAGCGGCCCACAGGCCACACCATGCTTCACCTTGCGTGCTCGATTGGCTATCATCGATTTGTTGCT
GCCTTGTTGGCCCGTGGAGCGAACCCGGATGCTCGAGACCGTGGCGGCTACACACCTCTGCACATGGCAGCAATC
CACAACCGTCCAGAGATTGCCAGACGTCTGATGATTGCTGGAGCCGACCCAACAGTGCGCAGTTTATCGGGTCTC
ACGGCGGCCGATGTGGCGCAATCACGCTTGGTCCTTAGGGCCATTCACCAGTCGGAGCGACGCTCACGTTCTTTT
AGTGGCGCTTCGCTACGCAGCCGGGCTAGCAGCAACACGTCGCTGCGGTCGCTGCTGGAGCCTTTGGCCAGGGCG
CAGACACACGACGAGCCGATTGCGCTTGATGCTGGAGAGGAAAGCCCAGAGTATACTTCGGGAGACTTTGAAGAC
GAAGACCCCGACGAGGACTGCTATGTGGATGCGAAGCGGCCCATGTGTCGCGAGCAAGAGGAAAAGGGCGTGCAA
GAATGGGATCAAGATGACAAGAGCGACGATTTGAATGGCCCAGAATCACCAACGACGCAATTGGCCGCGATCAAG
GAGGCGCTGAGAGACAACTTTCAACAGCCGCTGCATCAGTTTCAGCAGTCAATGGCATTGCACCTCCAGAACCTT
GCACAGATGCCGCAGATGCCGACGTTTCCTGGTATACCCATGCTGCCAGATTACCAGGCCTATCTTCAGCAGGCA
CCTTTTGTGCGACGCATGCAACAACTTATGCCTGGATCTGGACCTCGGCCGGAGGCGGCAGAGGAGGGCGGCAAA
CTGGATGGCCGGTGGTGGGACATCTTGTCATACATGCAGAGCAGTGCCGCCCCGCCAGCATACGAAGATATTTTT
GGACGACAGAGTTCTGACACGAAACAAGAGTGTGCGATTAGAGCCGCTGCAGATGCCGAAGCAGACATGAAGTGC
TCAGCCATGTACGACAAGCCAATGGCTGGAGTGGAAACAGAGGCAGAGGCGGCCGAGACTGGGTCGAGAAGCCGG
GCGAATTCGCCTGGGGTGCTCAAGATTGGACGCAAAAATGCCATTACCAAGGAGCAGCAAGAGCAGTTTCTCAGA
GCTCACGAAAAGAAGCTCAAGAAGATTAGCAGCGACCGCAACCTCTTTTTCATTTGGGTATGTTGCCAAGGACAC
ATTCTCTTATGTCTTGTCTTTGTTTTGGTTTTGCTTCTTGTTGGTTGGAGTCGAGTGGAGCTAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail